TkA08G387220 | RubberDandelionOmics

Gene overview

TkA08G387220

Reference: TK1151 Chr: Chr08 Coordinates: 98809888-98812693 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

798 bp · TkA08G387220|TK1151|cDNA

ATGGGTTCAAATCAAGCTAGCACTGACTCTCATCTACCAGTGAGCTACCCTCTCTGCTTCGCCTTCTCCACGACGTTCTTCACCCCCTCCTCAGATCTTAGCACCGAGTCGATGGGAAGCTCGAATTTAGAAATCAGTTTCACCGATGACTTTCTCTGTCAACGAGATCCAAATCAGGATAGAAGTGCATATTTTTTTCTCTTTTTTTTCATCATTGCTTATGGTGTTAAGATCATCTGTTTGGGATGGATGTTTCCCTG...

CDS

Download CDS FASTA

798 bp · TkA08G387220|TK1151|CDS

ATGGGTTCAAATCAAGCTAGCACTGACTCTCATCTACCAGTGAGCTACCCTCTCTGCTTCGCCTTCTCCACGACGTTCTTCACCCCCTCCTCAGATCTTAGCACCGAGTCGATGGGAAGCTCGAATTTAGAAATCAGTTTCACCGATGACTTTCTCTGTCAACGAGATCCAAATCAGGATAGAAGTGCATATTTTTTTCTCTTTTTTTTCATCATTGCTTATGGTGTTAAGATCATCTGTTTGGGATGGATGTTTCCCTG...

Protein

Download Protein FASTA

265 aa · TkA08G387220|TK1151|PROTEIN

MGSNQASTDSHLPVSYPLCFAFSTTFFTPSSDLSTESMGSSNLEISFTDDFLCQRDPNQDRSAYFFLFFFIIAYGVKIICLGWMFPCITCPDLPGIAKRIAAGGYGVYATDYPGFGLSEGLHGYIPNFSDLVGNVIEQYTKIKGRPEVRGMPRFLLGQSMGGAVALKVHLKEQQEMKPPEPLQKVIIFLSRLMPKAKLVPQKDLAELMFRDSQKRKLAEKAASKDKQLKLYDGSYHCILEGESDERIFEVLDDIIAWLDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G387220`
TK1151 ID	TkA08G387220
OH-1004 ID	LXL04_034477
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G387220`
Location	Chr08:98809888-98812693 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034477` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006979 response to oxidative stress Biological Process GO:0009809 lignin biosynthetic process Biological Process GO:0010043 response to zinc ion Biological Process GO:0042542 response to hydrogen peroxide Biological Process GO:0046686 response to cadmium ion Biological Process GO:0005634 nucleus Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009506 plasmodesma Cellular Component GO:0009507 chloroplast Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	ath:AT1G52760 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.355

Rank 1 · TkA08G387220 · TK1151

Nucleus0.241

Rank 2 · TkA08G387220 · TK1151

Endoplasmic reticulum0.219

Rank 3 · TkA08G387220 · TK1151

Mitochondrion0.128

Rank 4 · TkA08G387220 · TK1151

Cell membrane0.094

Rank 5 · TkA08G387220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146Hydrolase_496-176 aa

PF00561Abhydrolase_196-187 aa

PF12697Abhydrolase_697-167 aa

PF00756Esterase149-173 aa

PF07859Abhydrolase_3154-194 aa

PF00561Abhydrolase_1208-240 aa

PF12146Hydrolase_4212-242 aa

PF12697Abhydrolase_6215-247 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G387220	`PF12146`	Hydrolase_4	96	176	7.1e-26	91.7
TkA08G387220	`PF00561`	Abhydrolase_1	96	187	0.00016	22.1
TkA08G387220	`PF12697`	Abhydrolase_6	97	167	1.9e-05	26.1
TkA08G387220	`PF00756`	Esterase	149	173	0.11	13.0
TkA08G387220	`PF07859`	Abhydrolase_3	154	194	0.3	11.5
TkA08G387220	`PF00561`	Abhydrolase_1	208	240	0.00016	22.1
TkA08G387220	`PF12146`	Hydrolase_4	212	242	7.1e-26	91.7
TkA08G387220	`PF12697`	Abhydrolase_6	215	247	1.9e-05	26.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card