LXL04_034477 | RubberDandelionOmics

Gene overview

LXL04_034477

Reference: OH-1004 Chr: Chr07 Coordinates: 102210439-102213244 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

798 bp · LXL04_034477|LXL04_034477|OH1004|cDNA

ATGGGTTCAAATCAAGCTAGCACTGACTCTCATCTACCAGTGAGCTACCCTCTCTGCTTCGCCTTCTCCACGACGTTCTTCACCCCCTCCTCAGATCTTAGCACCAAGTCGATGGGAAGCTCGAATTTAGAAATCAGTTTCACCCATGACTTTCTCTGTCAACGAGATCCAAATCAGGATAGAAGTGCAtatttttttctcttttttttcaTCATTGCTTATGGTGTTAAGATCATCTGTTTGGGATGGATGTTTCCCTG...

CDS

Download CDS FASTA

798 bp · LXL04_034477|LXL04_034477|OH1004|CDS

ATGGGTTCAAATCAAGCTAGCACTGACTCTCATCTACCAGTGAGCTACCCTCTCTGCTTCGCCTTCTCCACGACGTTCTTCACCCCCTCCTCAGATCTTAGCACCAAGTCGATGGGAAGCTCGAATTTAGAAATCAGTTTCACCCATGACTTTCTCTGTCAACGAGATCCAAATCAGGATAGAAGTGCATATTTTTTTCTCTTTTTTTTCATCATTGCTTATGGTGTTAAGATCATCTGTTTGGGATGGATGTTTCCCTG...

Protein

Download Protein FASTA

265 aa · LXL04_034477|LXL04_034477|OH1004|PROTEIN

MGSNQASTDSHLPVSYPLCFAFSTTFFTPSSDLSTKSMGSSNLEISFTHDFLCQRDPNQDRSAYFFLFFFIIAYGVKIICLGWMFPCITCPDLPGIAKRIAAGGYGVYAIDYPGFGLSEGLHGYIPNFSDLVGNVIEQHTKIKGRPEVRGMPRFLLGQSMGGAVALKVHLKEQQEMKPPEPLQKVIIFLSRLMPKAKLVPQKDLAELMFRDSQKRKLAEKAASKDKQLKLYDGSYHCILEGESDERIFEVLDDIIAWLDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034477`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034477

Location Chr07:102210439-102213244 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52760`	Esterase involved in the biosynthesis of lignin.	Acyl-CoA-binding protein 2 binds lysophospholipase 2 and lysoPC to promote tolerance to cadmium-induced oxidative stress in transgenic Arabidopsis.2010 · DOI: 10.1111/j.1365-313x.2010.04209.x A bifunctional enzyme that has both monoacylglycerol acyltransferase and acyl hydrolase activities.2012 · DOI: 10.1104/pp.112.202135

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034477 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G52760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.347

Rank 1 · LXL04_034477 · OH-1004

Nucleus0.236

Rank 2 · LXL04_034477 · OH-1004

Endoplasmic reticulum0.203

Rank 3 · LXL04_034477 · OH-1004

Mitochondrion0.135

Rank 4 · LXL04_034477 · OH-1004

Cell membrane0.089

Rank 5 · LXL04_034477 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146.16Hydrolase_496-176 aa

PF12697.14Abhydrolase_697-167 aa

PF12146.16Hydrolase_4212-242 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034477	`PF12146.16`	Hydrolase_4	96	176	7.7e-26	91.6
LXL04_034477	`PF12697.14`	Abhydrolase_6	97	167	3.3e-06	28.6
LXL04_034477	`PF12146.16`	Hydrolase_4	212	242	7.7e-26	91.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C942`	Arabidopsis thaliana	Caffeoylshikimate esterase	45.833%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card