TkA08G362630 | RubberDandelionOmics

Gene overview

TkA08G362630

Reference: TK1151 Chr: Chr08 Coordinates: 92904970-92905344 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

375 bp · TkA08G362630|TK1151|cDNA

ATGAAATTAAAAGCATTCGGAGATAGCAGAGTAGAAAAATTGAAGAGTTTCATGGGAAAATCATACGCAAAGTCTCCAAAATCAAAGTTGCGGATAATCGGGGTCACTACGGCGGTGCTGTTATGGACTTTTGTAGTTCAATTAACAGCAATAGGGGATGCTTGGGGACCTATGGTTTTGAAAGGTTGGGCTTCTCACAGTTCTCTTTCTGCTACTGATTATGATGTCAAATTATTACCCATTGTTCCTGCTAGAGTTCT...

CDS

Download CDS FASTA

375 bp · TkA08G362630|TK1151|CDS

ATGAAATTAAAAGCATTCGGAGATAGCAGAGTAGAAAAATTGAAGAGTTTCATGGGAAAATCATACGCAAAGTCTCCAAAATCAAAGTTGCGGATAATCGGGGTCACTACGGCGGTGCTGTTATGGACTTTTGTAGTTCAATTAACAGCAATAGGGGATGCTTGGGGACCTATGGTTTTGAAAGGTTGGGCTTCTCACAGTTCTCTTTCTGCTACTGATTATGATGTCAAATTATTACCCATTGTTCCTGCTAGAGTTCT...

Protein

Download Protein FASTA

124 aa · TkA08G362630|TK1151|PROTEIN

MKLKAFGDSRVEKLKSFMGKSYAKSPKSKLRIIGVTTAVLLWTFVVQLTAIGDAWGPMVLKGWASHSSLSATDYDVKLLPIVPARVLPRVSYLLLLLLETCCHIITNWHLPNLVILMVKNKGVQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G362630`
TK1151 ID	TkA08G362630
OH-1004 ID	LXL04_034124
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.300
Protein coverage (%)	TK1151 95.161 / OH-1004 36.760 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G362630

Location Chr08:92904970-92905344 (+)

Description Similar to RRT1: Rhamnogalacturonan I rhamnosyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02250`	Glycosyltransferase involved in the formation of rhamnogalacturonan I (RG-I) oligosaccharides in the seed coat mucilage, which is a specialized cell wall with abundant RG-I (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034124 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0007155 cell adhesion Biological Process

GO:0010214 seed coat development Biological Process

GO:0010395 rhamnogalacturonan I metabolic process Biological Process

GO:0045489 pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0080157 regulation of plant-type cell wall organization or biogenesis Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G14020

ath:AT2G03280

ath:AT3G02250

ath:AT5G01100

ath:AT5G15740

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.308

Rank 1 · TkA08G362630 · TK1151

Mitochondrion0.225

Rank 2 · TkA08G362630 · TK1151

Cytoplasm0.152

Rank 3 · TkA08G362630 · TK1151

Nucleus0.143

Rank 4 · TkA08G362630 · TK1151

Golgi apparatus0.137

Rank 5 · TkA08G362630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZR8`	Arabidopsis thaliana	sp\|Q93ZR8\|RRT2_ARATH Rhamnogalacturonan I rhamnosyltransferase 1	43.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card