TkA08G358770 | RubberDandelionOmics

Gene overview

TkA08G358770

Reference: TK1151 Chr: Chr08 Coordinates: 91973315-91974090 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

516 bp · TkA08G358770|TK1151|cDNA

GGCATTGCAAAGAGAATTGCTGGTGCTGGTTATGGTGTTTATGCCATTGATCATCCTGGTTTTGGCCTCGCTAAAGGACTCCATGGCTATATCCCCAACTTTAGTGATTTAGTTGGCAATGTAATCGAACAATACACAAAAATCAAAGGAAGACCTGAAGTGAGGGGGATGCCTAGGTTTCTTTTAGGGCAATCAATGGGAGGAGCTGTTGCACTTAAAGTTCATCTCAAAGAGCAACAGGAAATGAAGCCCCCGGAACC...

CDS

Download CDS FASTA

516 bp · TkA08G358770|TK1151|CDS

GGCATTGCAAAGAGAATTGCTGGTGCTGGTTATGGTGTTTATGCCATTGATCATCCTGGTTTTGGCCTCGCTAAAGGACTCCATGGCTATATCCCCAACTTTAGTGATTTAGTTGGCAATGTAATCGAACAATACACAAAAATCAAAGGAAGACCTGAAGTGAGGGGGATGCCTAGGTTTCTTTTAGGGCAATCAATGGGAGGAGCTGTTGCACTTAAAGTTCATCTCAAAGAGCAACAGGAAATGAAGCCCCCGGAACC...

Protein

Download Protein FASTA

171 aa · TkA08G358770|TK1151|PROTEIN

GIAKRIAGAGYGVYAIDHPGFGLAKGLHGYIPNFSDLVGNVIEQYTKIKGRPEVRGMPRFLLGQSMGGAVALKVHLKEQQEMKPPEPLQKVLIFLSRLTQKAKLVPQKDLAELMFRDPQKRKLAEKAASKDKQLKLYDGSYHCILEGESDERIFEVLDDIIAWLDSHCAVR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G358770`
TK1151 ID	TkA08G358770
OH-1004 ID	LXL04_034477
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.600
Protein coverage (%)	TK1151 100.000 / OH-1004 64.528 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G358770

Location Chr08:91973315-91974090 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g52760`	Esterase involved in the biosynthesis of lignin.	Acyl-CoA-binding protein 2 binds lysophospholipase 2 and lysoPC to promote tolerance to cadmium-induced oxidative stress in transgenic Arabidopsis.2010 · DOI: 10.1111/j.1365-313x.2010.04209.x A bifunctional enzyme that has both monoacylglycerol acyltransferase and acyl hydrolase activities.2012 · DOI: 10.1104/pp.112.202135

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034477 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009809 lignin biosynthetic process Biological Process

GO:0010043 response to zinc ion Biological Process

GO:0042542 response to hydrogen peroxide Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G52760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.343

Rank 1 · TkA08G358770 · TK1151

Cytoplasm0.238

Rank 2 · TkA08G358770 · TK1151

Extracellular0.149

Rank 3 · TkA08G358770 · TK1151

Mitochondrion0.126

Rank 4 · TkA08G358770 · TK1151

Lysosome / Vacuole0.105

Rank 5 · TkA08G358770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12146Hydrolase_42-82 aa

PF00561Abhydrolase_13-82 aa

PF12697Abhydrolase_68-73 aa

PF00756Esterase55-79 aa

PF07859Abhydrolase_359-93 aa

PF12697Abhydrolase_6116-153 aa

PF12146Hydrolase_4119-148 aa

PF00561Abhydrolase_1121-146 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G358770	`PF12146`	Hydrolase_4	2	82	2.3e-26	93.3
TkA08G358770	`PF00561`	Abhydrolase_1	3	82	0.00039	20.9
TkA08G358770	`PF12697`	Abhydrolase_6	8	73	3.6e-05	25.2
TkA08G358770	`PF00756`	Esterase	55	79	0.055	13.9
TkA08G358770	`PF07859`	Abhydrolase_3	59	93	0.14	12.6
TkA08G358770	`PF12697`	Abhydrolase_6	116	153	3.6e-05	25.2
TkA08G358770	`PF12146`	Hydrolase_4	119	148	2.3e-26	93.3
TkA08G358770	`PF00561`	Abhydrolase_1	121	146	0.00039	20.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C942`	Arabidopsis thaliana	sp\|Q9C942\|CSE_ARATH Caffeoylshikimate esterase	51.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card