TkA08G357110 | RubberDandelionOmics

Gene overview

TkA08G357110

Reference: TK1151 Chr: Chr08 Coordinates: 91480419-91486559 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2155 bp · TkA08G357110|TK1151|cDNA

GGAAACAAAGAAACCACAAATAAATTATAAACAACTGTCATAAAGTGTTTCTCTTCTCAAAAAAATGCCTCCACATAAACTTATAGTTATGACGATGCTTGTTCTCTTAATCATATCAAAAAAAAATTTCTCGGATGCTGCTACCGAGTGTACTCGATCTGAACAAAAAGCGCTTCTTAATTTCAAGGCAGGTCTTGTTGATCCCCAAGGTCGGCTTTCTTCATGGAAAGGAAATAGCTGCTGTGAGTGGCATGGTGTTG...

CDS

Download CDS FASTA

1680 bp · TkA08G357110|TK1151|CDS

ATGCCTCCACATAAACTTATAGTTATGACGATGCTTGTTCTCTTAATCATATCAAAAAAAAATTTCTCGGATGCTGCTACCGAGTGTACTCGATCTGAACAAAAAGCGCTTCTTAATTTCAAGGCAGGTCTTGTTGATCCCCAAGGTCGGCTTTCTTCATGGAAAGGAAATAGCTGCTGTGAGTGGCATGGTGTTGGCTGTGATAACTCCACAGGTTTTGTTACCAGAATTGATTTGCAAAACCCGTATCCTTTGAGTTA...

Protein

Download Protein FASTA

559 aa · TkA08G357110|TK1151|PROTEIN

MPPHKLIVMTMLVLLIISKKNFSDAATECTRSEQKALLNFKAGLVDPQGRLSSWKGNSCCEWHGVGCDNSTGFVTRIDLQNPYPLSYGDGQRGISGEIRPALVKLKYLTYFDLSYNTFVNNQIPEFIGLLTNLRYLNLSTTGFSGQIPRNIGNLSHLQYLDVSSKFGDLKVDSLEWLTKLSNLKHMKMNNVDLSLVDGNWSGMLKNHTSLTLLHLRSCGLSTLSPFDLPSLSDLDLSMNSFNYKFPDWILNLTTLSSLDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G357110`
TK1151 ID	TkA08G357110
OH-1004 ID	LXL04_034097
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.900
Protein coverage (%)	TK1151 92.665 / OH-1004 50.585 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G357110

Location Chr08:91480419-91486559 (+)

Description Similar to EIX2: Receptor-like protein EIX2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25010`	May be involved in ABA-induced senescence responses.	Gene silencing to investigate the roles of receptor-like proteins in Arabidopsis.2008 · DOI: 10.4161/psb.3.10.6543

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034097 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0007165 signal transduction Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G47890

ath:AT1G74170

ath:AT2G15080

sly:543900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.743

Rank 1 · TkA08G357110 · TK1151

Endoplasmic reticulum0.121

Rank 2 · TkA08G357110 · TK1151

Cytoplasm0.075

Rank 3 · TkA08G357110 · TK1151

Extracellular0.060

Rank 4 · TkA08G357110 · TK1151

Nucleus0.057

Rank 5 · TkA08G357110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_233-68 aa

PF12799LRR_497-119 aa

PF23598LRR_1498-164 aa

PF25013LRR_Zer-1102-165 aa

PF13855LRR_8103-140 aa

PF13516LRR_6106-117 aa

PF16837SF3A3106-112 aa

PF24141LRR_ComC107-194 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G357110	`PF08263`	LRRNT_2	33	68	2e-12	47.9
TkA08G357110	`PF12799`	LRR_4	97	119	2e-27	95.3
TkA08G357110	`PF23598`	LRR_14	98	164	2.6e-26	93.0
TkA08G357110	`PF25013`	LRR_Zer-1	102	165	1.1e-07	32.7
TkA08G357110	`PF13855`	LRR_8	103	140	2.9e-28	98.1
TkA08G357110	`PF13516`	LRR_6	106	117	5.6e-08	33.0
TkA08G357110	`PF16837`	SF3A3	106	112	0.13	13.1
TkA08G357110	`PF24141`	LRR_ComC	107	194	8.9e-05	23.0
TkA08G357110	`PF00560`	LRR_1	108	128	2.5e-32	104.6
TkA08G357110	`PF12799`	LRR_4	108	141	2e-27	95.3
TkA08G357110	`PF29594`	LRR_SKP2	108	189	0.00028	20.9
TkA08G357110	`PF12799`	LRR_4	131	168	2e-27	95.3
TkA08G357110	`PF13516`	LRR_6	131	139	5.6e-08	33.0
TkA08G357110	`PF00560`	LRR_1	132	154	2.5e-32	104.6
TkA08G357110	`PF16837`	SF3A3	134	170	0.13	13.1
TkA08G357110	`PF24758`	LRR_At5g56370	146	218	0.0014	19.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJS2`	Arabidopsis thaliana	sp\|Q9LJS2\|RLP41_ARATH Receptor-like protein 41	29.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card