LXL04_034097 | RubberDandelionOmics

Gene overview

LXL04_034097

Reference: OH-1004 Chr: Chr07 Coordinates: 81788244-81791324 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3081 bp · LXL04_034097|LXL04_034097|OH1004|cDNA

ATGCCTCCACATAAACTTATAGTTATGACGATGCTTGTTCTCTTAATCATATCAAAAATTCTTTTCTCAGATGCTGCTACCGAGTGTACTCGATCTGAACTAAAAGCGCTTCTTAACTTCAAGGCAGGTCTTGTTGATCCCCAAGGTCGGCTTTCTTCATGGAAAGGAAATAGCTGCTGTGAGTGGCATGGTGTTGGCTGTGATAACTCCACAGGTTTTGTTACCAGAATTGATTTGCAAAACCCGTATCCTTTGAGTTA...

CDS

Download CDS FASTA

3081 bp · LXL04_034097|LXL04_034097|OH1004|CDS

ATGCCTCCACATAAACTTATAGTTATGACGATGCTTGTTCTCTTAATCATATCAAAAATTCTTTTCTCAGATGCTGCTACCGAGTGTACTCGATCTGAACTAAAAGCGCTTCTTAACTTCAAGGCAGGTCTTGTTGATCCCCAAGGTCGGCTTTCTTCATGGAAAGGAAATAGCTGCTGTGAGTGGCATGGTGTTGGCTGTGATAACTCCACAGGTTTTGTTACCAGAATTGATTTGCAAAACCCGTATCCTTTGAGTTA...

Protein

Download Protein FASTA

1026 aa · LXL04_034097|LXL04_034097|OH1004|PROTEIN

MPPHKLIVMTMLVLLIISKILFSDAATECTRSELKALLNFKAGLVDPQGRLSSWKGNSCCEWHGVGCDNSTGFVTRIDLQNPYPLSYGDDQRGISGEIRPSLVKLKYLTYFDLSYNTFVNNQIPEFIGLLTNLRYLNLSTTGFSGQIPRNIGNLSHLQYLDVSSKFGDLKVDSLEWLTKLSNLKHMKMNNVDLSLVDGNWSGMLKNHTSLTLLHLRSCGLSTLSPFDLPSLSDLDLSMNSFNYKFPDWILNLTTLSSLDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034097`
TK1151 ID	TkA08G357110
OH-1004 ID	LXL04_034097
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.900
Protein coverage (%)	TK1151 92.665 / OH-1004 50.585 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034097

Location Chr07:81788244-81791324 (+)

Description Similar to EIX2: Receptor-like protein EIX2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g74170`	Receptor-like protein 13.	No verified direct reference in this release
`At1g47890`	Receptor-like protein 7.	No verified direct reference in this release
`At2g15080`	Receptor-like protein 19.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034097 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0007165 signal transduction Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G47890

ath:AT1G74170

ath:AT2G15080

sly:543900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.860

Rank 1 · LXL04_034097 · OH-1004

Endoplasmic reticulum0.089

Rank 2 · LXL04_034097 · OH-1004

Cytoplasm0.057

Rank 3 · LXL04_034097 · OH-1004

Nucleus0.043

Rank 4 · LXL04_034097 · OH-1004

Lysosome / Vacuole0.023

Rank 5 · LXL04_034097 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_232-68 aa

PF23598.2LRR_1498-183 aa

PF13855.13LRR_8209-263 aa

PF13855.13LRR_8277-339 aa

PF12799.14LRR_4327-370 aa

PF13855.13LRR_8385-445 aa

PF23598.2LRR_14386-535 aa

PF13855.13LRR_8434-494 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034097	`PF08263.18`	LRRNT_2	32	68	1.9e-12	47.9
LXL04_034097	`PF23598.2`	LRR_14	98	183	3.6e-46	158.2
LXL04_034097	`PF13855.13`	LRR_8	209	263	3.3e-51	171.6
LXL04_034097	`PF13855.13`	LRR_8	277	339	3.3e-51	171.6
LXL04_034097	`PF12799.14`	LRR_4	327	370	3.2e-39	132.8
LXL04_034097	`PF13855.13`	LRR_8	385	445	3.3e-51	171.6
LXL04_034097	`PF23598.2`	LRR_14	386	535	3.6e-46	158.2
LXL04_034097	`PF13855.13`	LRR_8	434	494	3.3e-51	171.6
LXL04_034097	`PF13855.13`	LRR_8	669	708	3.3e-51	171.6
LXL04_034097	`PF13855.13`	LRR_8	673	731	3.3e-51	171.6
LXL04_034097	`PF13855.13`	LRR_8	746	793	3.3e-51	171.6
LXL04_034097	`PF23598.2`	LRR_14	829	915	3.6e-46	158.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6A6`	Arabidopsis thaliana	Receptor-like protein 13	29.507%	Swiss-Prot	weak database homology
`Q9C699`	Arabidopsis thaliana	Receptor-like protein 7	30.740%	Swiss-Prot	moderate database homology
`Q9ZUK3`	Arabidopsis thaliana	Receptor-like protein 19	30.769%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card