TkA08G352770 | RubberDandelionOmics

Gene overview

TkA08G352770

Reference: TK1151 Chr: Chr08 Coordinates: 90420387-90420989 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · TkA08G352770|TK1151|cDNA

ATGTGTCACGTTTTCTTGAATTTGCCACTTCTCTTGCTTGAGACTACAAGTGGCACTTCTCTTGGCAACCATTTGGTGGTAGGAGGGAAAAAGGATACAGGTGTTGTCAGAACCTGTTTGGATAATGAGAGACATGCTCTCCTTCATTTCAAAGCTCGCCTTCAAGACCCTTACGGCCATCTCTCCACGTGGAGAGCTGAAGAAGATGATTGCTGCAAATGGAAAGGAGTCACGTGCAACAACCAAACAGGTCGTGTCAC...

CDS

Download CDS FASTA

432 bp · TkA08G352770|TK1151|CDS

ATGTGTCACGTTTTCTTGAATTTGCCACTTCTCTTGCTTGAGACTACAAGTGGCACTTCTCTTGGCAACCATTTGGTGGTAGGAGGGAAAAAGGATACAGGTGTTGTCAGAACCTGTTTGGATAATGAGAGACATGCTCTCCTTCATTTCAAAGCTCGCCTTCAAGACCCTTACGGCCATCTCTCCACGTGGAGAGCTGAAGAAGATGATTGCTGCAAATGGAAAGGAGTCACGTGCAACAACCAAACAGGTCGTGTCAC...

Protein

Download Protein FASTA

143 aa · TkA08G352770|TK1151|PROTEIN

MCHVFLNLPLLLLETTSGTSLGNHLVVGGKKDTGVVRTCLDNERHALLHFKARLQDPYGHLSTWRAEEDDCCKWKGVTCNNQTGRVTKLDLSYGHLVGTIPRSVGNLTRLRYLDLGFNNFNGTIPSSIGSLSELRTLHSTGFP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G352770`
TK1151 ID	TkA08G352770
OH-1004 ID	LXL04_004351
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.600
Protein coverage (%)	TK1151 78.322 / OH-1004 13.442 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G352770

Location Chr08:90420387-90420989 (-)

Description Similar to EIX1: Receptor-like protein EIX1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05360`	Receptor for microbe-associated molecular patterns (MAMPs) that induces a BAK1-dependent basal immune response to necrotrophic fungi (e.g. S.sclerotiorum) in the presence of MAMPs (e.g. flg22 and SCLEROTINIA CULTURE FILTRATE ELICITOR1 (SCFE1) from the necrotrophic fungal pathogen S.sclerotiorum).	Arabidopsis receptor-like protein30 and receptor-like kinase suppressor of BIR1-1/EVERSHED mediate innate immunity to necrotrophic fungi.2013 · DOI: 10.1105/tpc.113.117010

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004351 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0007165 signal transduction Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0090696 post-embryonic plant organ development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G71400

dosa:Os04g0576900

osa:4336741

sly:543900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.654

Rank 1 · TkA08G352770 · TK1151

Extracellular0.142

Rank 2 · TkA08G352770 · TK1151

Endoplasmic reticulum0.111

Rank 3 · TkA08G352770 · TK1151

Cytoplasm0.080

Rank 4 · TkA08G352770 · TK1151

Nucleus0.040

Rank 5 · TkA08G352770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01557FAA_hydrolase37-116 aa

PF08263LRRNT_241-80 aa

PF13855LRR_885-138 aa

PF00560LRR_186-107 aa

PF12799LRR_486-125 aa

PF13516LRR_686-95 aa

PF23598LRR_14101-138 aa

PF00560LRR_1109-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G352770	`PF01557`	FAA_hydrolase	37	116	0.36	11.2
TkA08G352770	`PF08263`	LRRNT_2	41	80	3.6e-14	53.5
TkA08G352770	`PF13855`	LRR_8	85	138	3.3e-06	27.5
TkA08G352770	`PF00560`	LRR_1	86	107	1.1e-07	31.3
TkA08G352770	`PF12799`	LRR_4	86	125	0.0008	20.3
TkA08G352770	`PF13516`	LRR_6	86	95	0.098	13.5
TkA08G352770	`PF23598`	LRR_14	101	138	0.00023	20.7
TkA08G352770	`PF00560`	LRR_1	109	131	1.1e-07	31.3
TkA08G352770	`PF13516`	LRR_6	110	122	0.098	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MA83`	Arabidopsis thaliana	sp\|Q9MA83\|RLP30_ARATH Receptor-like protein 30	44.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card