LXL04_004351 | RubberDandelionOmics

Gene overview

LXL04_004351

Reference: OH-1004 Chr: Chr01 Coordinates: 133261096-133263772 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2391 bp · LXL04_004351|LXL04_004351|OH1004|cDNA

ATGATAAACAAGATTTTCCTTTACTTTATGTGTCACGTTTTCTTGAATTTGCCACTTCTCTTGCTTGAGACTACAAGTGGCACTTCTCTTGGCAACCATTTGGTGGTAGGAGGGAAAAAGGATACAGGTGTTGTCAGAACCTGTTTGGATAATGAGAGACATGCTCTCCTACATTTCAAAGCTCGCCTTCAAGACCCTTACGGCCATCTCTCCACGTGGAGAGCTGAAGAAGATGATTGCTGCAAATGGAAAGGAGTCAC...

CDS

Download CDS FASTA

2391 bp · LXL04_004351|LXL04_004351|OH1004|CDS

ATGATAAACAAGATTTTCCTTTACTTTATGTGTCACGTTTTCTTGAATTTGCCACTTCTCTTGCTTGAGACTACAAGTGGCACTTCTCTTGGCAACCATTTGGTGGTAGGAGGGAAAAAGGATACAGGTGTTGTCAGAACCTGTTTGGATAATGAGAGACATGCTCTCCTACATTTCAAAGCTCGCCTTCAAGACCCTTACGGCCATCTCTCCACGTGGAGAGCTGAAGAAGATGATTGCTGCAAATGGAAAGGAGTCAC...

Protein

Download Protein FASTA

796 aa · LXL04_004351|LXL04_004351|OH1004|PROTEIN

MINKIFLYFMCHVFLNLPLLLLETTSGTSLGNHLVVGGKKDTGVVRTCLDNERHALLHFKARLQDPYGHLSTWRAEEDDCCKWKGVTCNNQTGHVTKLDLSGTIPRSVGNLTRLRYLDLGFNNLNGTIPSSIGSLSELRYLDLSFNYGIILEEFKNLTNLDWLRHLSHLQNLALDGISLAKANDWVNVILSLPKLSHLSLQECELSHIMSPYSAFINSSSSIEALSHGNNNLNSSILKSLAFNHSNAVVKLHDFLNGLFG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004351`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004351

Location Chr01:133261096-133263772 (+)

Description Similar to EIX1: Receptor-like protein EIX1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71400`	Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance.	Functional analyses of the CLAVATA2-like proteins and their domains that contribute to CLAVATA2 specificity.2010 · DOI: 10.1104/pp.109.148197
`At5g46330`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0576900`	Functions in the early stages of organ development by regulating cell division rate.	XIAO is involved in the control of organ size by contributing to the regulation of signaling and homeostasis of brassinosteroids and cell cycling in rice.2012 · DOI: 10.1111/j.1365-313x.2011.04877.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004351 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0007165 signal transduction Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0090696 post-embryonic plant organ development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G71400

dosa:Os04g0576900

osa:4336741

sly:543900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.841

Rank 1 · LXL04_004351 · OH-1004

Endoplasmic reticulum0.093

Rank 2 · LXL04_004351 · OH-1004

Cytoplasm0.061

Rank 3 · LXL04_004351 · OH-1004

Nucleus0.041

Rank 4 · LXL04_004351 · OH-1004

Extracellular0.027

Rank 5 · LXL04_004351 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_250-89 aa

PF13855.13LRR_8107-146 aa

PF23598.2LRR_14108-201 aa

PF12799.14LRR_4112-149 aa

PF13855.13LRR_8113-163 aa

PF13855.13LRR_8285-324 aa

PF23598.2LRR_14481-625 aa

PF13855.13LRR_8485-516 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004351	`PF08263.18`	LRRNT_2	50	89	2.5e-13	50.8
LXL04_004351	`PF13855.13`	LRR_8	107	146	3.1e-36	123.7
LXL04_004351	`PF23598.2`	LRR_14	108	201	5.8e-25	88.5
LXL04_004351	`PF12799.14`	LRR_4	112	149	3.4e-25	88.2
LXL04_004351	`PF13855.13`	LRR_8	113	163	3.1e-36	123.7
LXL04_004351	`PF13855.13`	LRR_8	285	324	3.1e-36	123.7
LXL04_004351	`PF23598.2`	LRR_14	481	625	5.8e-25	88.5
LXL04_004351	`PF13855.13`	LRR_8	485	516	3.1e-36	123.7
LXL04_004351	`PF12799.14`	LRR_4	505	540	3.4e-25	88.2
LXL04_004351	`PF13855.13`	LRR_8	577	626	3.1e-36	123.7
LXL04_004351	`PF13855.13`	LRR_8	652	711	3.1e-36	123.7
LXL04_004351	`PF23598.2`	LRR_14	666	747	5.8e-25	88.5
LXL04_004351	`PF13855.13`	LRR_8	697	733	3.1e-36	123.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9H7`	Arabidopsis thaliana	Receptor-like protein 12	32.258%	Swiss-Prot	moderate database homology
`Q9FL28`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase FLS2	30.825%	Swiss-Prot	moderate database homology
`G9LZD7`	Oryza sativa subsp. japonica	Probable inactive leucine-rich repeat receptor kinase XIAO	31.455%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card