TkA08G343450 | RubberDandelionOmics

Gene overview

TkA08G343450

Reference: TK1151 Chr: Chr08 Coordinates: 88025710-88034379 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1536 bp · TkA08G343450|TK1151|cDNA

AGCTTTGTTATTTTCTCTATGTTCCTGTTCACCTGCCGTGTATTTGACACCGGATTATTTGACTTTGAGATATTAAGCCTCTCATTAACCATAAGAATCCCATATATCTTCTTTCATCTTGTAGAGAATTGAGTACACACCAAAATGAAGTTGCTAGATTGGATGCATCGCAAGTTTAGGAACGGAGAGCCACTAAAAGAATTTCCTACAGGGAACCCTTGTACTTGTCTTATGGGGCAACCATCACTCGACGATTTAGA...

CDS

Download CDS FASTA

1107 bp · TkA08G343450|TK1151|CDS

ATGAAGTTGCTAGATTGGATGCATCGCAAGTTTAGGAACGGAGAGCCACTAAAAGAATTTCCTACAGGGAACCCTTGTACTTGTCTTATGGGGCAACCATCACTCGACGATTTAGAGTATTATCCTAAATCAAACTATTACGCGAAACCATCGACCAAATCACGTGAAAATCAGCTCCTAAAATCGTTTTCATGCATAAGAGCAGATGACGAACACATGGGAGAAGAAGAATCATCGTCTGCTCTTTCCGAACTCTTTCA...

Protein

Download Protein FASTA

368 aa · TkA08G343450|TK1151|PROTEIN

MKLLDWMHRKFRNGEPLKEFPTGNPCTCLMGQPSLDDLEYYPKSNYYAKPSTKSRENQLLKSFSCIRADDEHMGEEESSSALSELFHGFLAIGTLGTDPVTSDPATPTFSTSVQYIMEKETEATENELQFFNDELEKVLGADGKEDDSSRRDSYVSVGRSSHGSTITLGGKPLEAAENEIGGVACPLQGYLFGSTVGLPETTPGKKEHRTSLGELFQKTKIAEESNGVKCNHTRVEKQKEKDADKSAVHLVKKILKGIKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G343450`
TK1151 ID	TkA08G343450
OH-1004 ID	LXL04_025745
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.700
Protein coverage (%)	TK1151 99.457 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G343450

Location Chr08:88025710-88034379 (+)

Description Similar to LA1: Protein LAZY 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g14090`	Involved in the regulation of shoot gravitropism.	AtLAZY1 is a signaling component required for gravitropism of the Arabidopsis thaliana inflorescence.2013 · DOI: 10.1111/tpj.12118 Strigolactones regulate rice tiller angle by attenuating shoot gravitropism through inhibiting auxin biosynthesis.2014 · DOI: 10.1073/pnas.1411859111 The Arabidopsis LAZY1 Family Plays a Key Role in Gravity Signaling within Statocytes and in Branch Angle Control of Roots and Shoots.2017 · DOI: 10.1105/tpc.16.00575 LAZY Genes Mediate the Effects of Gravity on Auxin Gradients and Plant Architecture.2017 · DOI: 10.1104/pp.17.00942

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0490600`	Involved in the regulation of shoot gravitropism and tiller angle through negative regulation of basipetal polar auxin transport (PAT).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025745 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009630 gravitropism Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0009959 negative gravitropism Biological Process

GO:2000012 regulation of auxin polar transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT5G14090

dosa:Os11g0490600

zma:100193776

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.476

Rank 1 · TkA08G343450 · TK1151

Nucleus0.355

Rank 2 · TkA08G343450 · TK1151

Cytoplasm0.351

Rank 3 · TkA08G343450 · TK1151

Endoplasmic reticulum0.053

Rank 4 · TkA08G343450 · TK1151

Mitochondrion0.031

Rank 5 · TkA08G343450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28425LAZY_C61-147 aa

PF12878SICA_beta209-274 aa

PF28425LAZY_C229-368 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G343450	`PF28425`	LAZY_C	61	147	2.6e-09	37.9
TkA08G343450	`PF12878`	SICA_beta	209	274	0.26	12.1
TkA08G343450	`PF28425`	LAZY_C	229	368	2.6e-09	37.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5XV40`	Arabidopsis thaliana	sp\|Q5XV40\|LAZY1_ARATH Protein LAZY 1	35.700%	Swiss-Prot	Medium
`Q2R435`	Oryza sativa subsp. japonica	sp\|Q2R435\|LAZY1_ORYSJ Protein LAZY 1	27.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card