TkA08G289620 | RubberDandelionOmics

Gene overview

TkA08G289620

Reference: TK1151 Chr: Chr08 Coordinates: 75130723-75132097 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1110 bp · TkA08G289620|TK1151|cDNA

ATGAAAACATCATTGGCTTCATTGTGTGATGTAGATGAAGAGAAGATTATAGTTTATAATTTAGCTATCAATGGAAGCATGGATCAGCATCTCCATGAACCCGATCCCAATGACAGGCATTGCCTAACATGGGCACAACGTCTGAAGATATGCATAGGGGTAGCAAGAGGACTTGAGTACCTACATTCGGGTCTTGAGAAGGACAATCGAGTAATTCATCGAAACATAAAGGCCTCTAATATACTATTCGATGTCGGTTT...

CDS

Download CDS FASTA

1110 bp · TkA08G289620|TK1151|CDS

ATGAAAACATCATTGGCTTCATTGTGTGATGTAGATGAAGAGAAGATTATAGTTTATAATTTAGCTATCAATGGAAGCATGGATCAGCATCTCCATGAACCCGATCCCAATGACAGGCATTGCCTAACATGGGCACAACGTCTGAAGATATGCATAGGGGTAGCAAGAGGACTTGAGTACCTACATTCGGGTCTTGAGAAGGACAATCGAGTAATTCATCGAAACATAAAGGCCTCTAATATACTATTCGATGTCGGTTT...

Protein

Download Protein FASTA

369 aa · TkA08G289620|TK1151|PROTEIN

MKTSLASLCDVDEEKIIVYNLAINGSMDQHLHEPDPNDRHCLTWAQRLKICIGVARGLEYLHSGLEKDNRVIHRNIKASNILFDVGFQAKISDFALSLLVDRNQPEAYDYLERTSYYTDPIVNEGGLTNTKSDVYSFGVVLLEMLSGMEGQHFLDSHNDGQQTLVNLVRRHYDDGLDHLVDPLICDHVNTLSFRVFIRIVYRCISLKLENRPTIKTIIKRIEEAQDLQNQDEAGSTMAMQNRQHQDPEIFRISPEEIKLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G289620`
TK1151 ID	TkA08G289620
OH-1004 ID	LXL04_031671
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	54.600
Protein coverage (%)	TK1151 97.832 / OH-1004 45.663 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G289620

Location Chr08:75130723-75132097 (+)

Description Similar to At5g59700: Probable receptor-like protein kinase At5g59700

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At5g38990`	Probable receptor-like protein kinase At5g38990.	No verified direct reference in this release
`At5g48740`	Probable LRR receptor-like serine/threonine-protein kinase At5g48740.	No verified direct reference in this release
`At1g01540`	Probable serine/threonine-protein kinase At1g01540.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0541400`	Involved in disease resistance.	A Genetic Screen Identifies a Requirement for Cysteine-Rich-Receptor-Like Kinases in Rice NH1 (OsNPR1)-Mediated Immunity.2016 · DOI: 10.1371/journal.pgen.1006049

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031671 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0051924 regulation of calcium ion transport Biological Process

GO:0080147 root hair cell development Biological Process

GO:0097275 intracellular ammonium homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0043680 filiform apparatus Cellular Component

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G59700

ath:AT5G61350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.458

Rank 1 · TkA08G289620 · TK1151

Cell membrane0.449

Rank 2 · TkA08G289620 · TK1151

Nucleus0.267

Rank 3 · TkA08G289620 · TK1151

Endoplasmic reticulum0.041

Rank 4 · TkA08G289620 · TK1151

Golgi apparatus0.038

Rank 5 · TkA08G289620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr6-220 aa

PF00069Pkinase8-219 aa

PF00069Pkinase265-356 aa

PF07714PK_Tyr_Ser-Thr267-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G289620	`PF07714`	PK_Tyr_Ser-Thr	6	220	2.4e-43	149.1
TkA08G289620	`PF00069`	Pkinase	8	219	9.3e-36	124.3
TkA08G289620	`PF00069`	Pkinase	265	356	9.3e-36	124.3
TkA08G289620	`PF07714`	PK_Tyr_Ser-Thr	267	363	2.4e-43	149.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FID8`	Arabidopsis thaliana	sp\|Q9FID8\|Y5900_ARATH Putative receptor-like protein kinase At5g39000	35.700%	Swiss-Prot	Medium
`Q9FID9`	Arabidopsis thaliana	sp\|Q9FID9\|Y5389_ARATH Probable receptor-like protein kinase At5g38990	35.200%	Swiss-Prot	Medium
`C0LGV0`	Arabidopsis thaliana	sp\|C0LGV0\|Y5487_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g48740	35.800%	Swiss-Prot	Medium
`Q3EDL4`	Arabidopsis thaliana	sp\|Q3EDL4\|Y1154_ARATH Probable serine/threonine-protein kinase At1g01540	30.700%	Swiss-Prot	Medium
`Q0D5R3`	Oryza sativa subsp. japonica	sp\|Q0D5R3\|CRK6_ORYSJ Cysteine-rich receptor-like protein kinase 6	37.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card