LXL04_031671 | RubberDandelionOmics

Gene overview

LXL04_031671

Reference: OH-1004 Chr: Chr07 Coordinates: 9409393-9412772 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2355 bp · LXL04_031671|LXL04_031671|OH1004|cDNA

ATGTCTTCTTCACAAGATGTCCTAAAAAGTTTTACAATTCCATTAAAGGATATCAAAAAGTCCACCCGAAATTTCAGTCCAGAATCTCGCATCGGAGGTGGTGAATTTGGTGTGGTCTACAAAGGACAAGTCTTCAAGCGTTGGCAAAACCGCATAGTTGCCTTTAAACGCTTTGACCCCGATGGTTATGAAGGAGATCATGAATTCCCTGATGAGGTTGTAATGATACTTAATGTTAATCATGACAACATCATCCCTTT...

CDS

Download CDS FASTA

2355 bp · LXL04_031671|LXL04_031671|OH1004|CDS

ATGTCTTCTTCACAAGATGTCCTAAAAAGTTTTACAATTCCATTAAAGGATATCAAAAAGTCCACCCGAAATTTCAGTCCAGAATCTCGCATCGGAGGTGGTGAATTTGGTGTGGTCTACAAAGGACAAGTCTTCAAGCGTTGGCAAAACCGCATAGTTGCCTTTAAACGCTTTGACCCCGATGGTTATGAAGGAGATCATGAATTCCCTGATGAGGTTGTAATGATACTTAATGTTAATCATGACAACATCATCCCTTT...

Protein

Download Protein FASTA

784 aa · LXL04_031671|LXL04_031671|OH1004|PROTEIN

MSSSQDVLKSFTIPLKDIKKSTRNFSPESRIGGGEFGVVYKGQVFKRWQNRIVAFKRFDPDGYEGDHEFPDEVVMILNVNHDNIIPFIGYCKEAKQKIIVYEYAVNGSLDHHIQDPIKRRYLTLGTKAEDLYRGSPGTRVPSLGYWSGRDNSTQKHQSGMLANEKRSIDDRSPKTLMNLVRQYYANGLEKVIDPCIKVQIGNHSLHMFKEVAYECISFRSKDRPTIGNIIKRMEEALDIQNHAATSTITIPSHIYQNLQR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_031671`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_031671

Location Chr07:9409393-9412772 (+)

Description Similar to At5g59700: Probable receptor-like protein kinase At5g59700

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At5g61350`	Probable receptor-like protein kinase At5g61350.	No verified direct reference in this release
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g39000`	Putative receptor-like protein kinase At5g39000.	No verified direct reference in this release
`At2g39360`	Probable receptor-like protein kinase At2g39360.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031671 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0051924 regulation of calcium ion transport Biological Process

GO:0080147 root hair cell development Biological Process

GO:0097275 intracellular ammonium homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0043680 filiform apparatus Cellular Component

GO:0004672 protein kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G59700

ath:AT5G61350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.602

Rank 1 · LXL04_031671 · OH-1004

Cell membrane0.270

Rank 2 · LXL04_031671 · OH-1004

Nucleus0.268

Rank 3 · LXL04_031671 · OH-1004

Endoplasmic reticulum0.046

Rank 4 · LXL04_031671 · OH-1004

Mitochondrion0.045

Rank 5 · LXL04_031671 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase27-115 aa

PF07714.24PK_Tyr_Ser-Thr29-116 aa

PF00069.32Pkinase277-549 aa

PF07714.24PK_Tyr_Ser-Thr278-550 aa

PF00069.32Pkinase593-771 aa

PF07714.24PK_Tyr_Ser-Thr595-752 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_031671	`PF00069.32`	Pkinase	27	115	1.4e-86	290.9
LXL04_031671	`PF07714.24`	PK_Tyr_Ser-Thr	29	116	5.4e-90	301.9
LXL04_031671	`PF00069.32`	Pkinase	277	549	1.4e-86	290.9
LXL04_031671	`PF07714.24`	PK_Tyr_Ser-Thr	278	550	5.4e-90	301.9
LXL04_031671	`PF00069.32`	Pkinase	593	771	1.4e-86	290.9
LXL04_031671	`PF07714.24`	PK_Tyr_Ser-Thr	595	752	5.4e-90	301.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN92`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g59700	39.474%	Swiss-Prot	weak database homology
`Q9FLJ8`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g61350	36.657%	Swiss-Prot	weak database homology
`Q9LX66`	Arabidopsis thaliana	Receptor-like protein kinase HERK 1	38.944%	Swiss-Prot	weak database homology
`Q9FID8`	Arabidopsis thaliana	Putative receptor-like protein kinase At5g39000	39.264%	Swiss-Prot	weak database homology
`O80623`	Arabidopsis thaliana	Probable receptor-like protein kinase At2g39360	36.246%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card