TkA08G279490 | RubberDandelionOmics

Gene overview

TkA08G279490

Reference: TK1151 Chr: Chr08 Coordinates: 72672295-72677621 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4131 bp · TkA08G279490|TK1151|cDNA

AATTTTACCTAGTTTGACATTATCATTAATAGTTCTTGTTTTTTCAGCAGGTGAATTCAAAGATAGTGTAAATCTTATAAGTTCTCAAATGGCTGACCTGCTAGTAGGTTTTGCTAGTAATGTGTTAGCTAAACTTGGAGAAAAGCTTTTTGTTGCAACTGGTCGTCACCTAAGATATGTACTTTACTATAACAACTACATTCAAATTCTAGAAAAAGAAGTGGACAAATTAATGGTAAAATCACAAGATATCAAACGAG...

CDS

Download CDS FASTA

1653 bp · TkA08G279490|TK1151|CDS

ATGAAAATCGCTCTAAAAGAGCTAGATCCAAGTGGTTTTCAGCAAATCAAGAACTTAACTGTTGAATCTTGCAACAATGAAGGAACAGAGTATCTTTCAGATTACAGCTACGCATCAAACGGCGGCGATGTGTTTACTAATTTGGAAAAACTTCGAATCGATAAAATCTGGCATTTGAAGGGAATTTTAAGAAACAATGGAAAAGGGCTTCCGATTAAATCATTTTCAAAGTTACGCAAGATTCATTTGTCGGTTTTACC...

Protein

Download Protein FASTA

550 aa · TkA08G279490|TK1151|PROTEIN

MKIALKELDPSGFQQIKNLTVESCNNEGTEYLSDYSYASNGGDVFTNLEKLRIDKIWHLKGILRNNGKGLPIKSFSKLRKIHLSVLPEMTHLFTYHVANNLVHLERLHIEYCTNMQQVILNQRPSALDSTTENKIVFLKLTELILNDVASLICFSHGISMQVEFPQLRVLKLEYLQNFLTFCPDEINLASKGTHRDTDFQSLVDHKVEFSILAELTITNISNIKQVWCGHLPNLVHLQGLYIQFCHMMEEVISVQRASVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G279490`
TK1151 ID	TkA08G279490
OH-1004 ID	LXL04_035536
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	22.600
Protein coverage (%)	TK1151 66.909 / OH-1004 30.732 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G279490`
Location	Chr08:72672295-72677621 (+)
Description	Similar to At4g27220: Probable disease resistance protein At4g27220
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035536` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process GO:0006952 defense response Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0012501 programmed cell death Biological Process GO:0016045 detection of bacterium Biological Process GO:0042742 defense response to bacterium Biological Process GO:0098542 defense response to other organism Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005886 plasma membrane Cellular Component GO:0000166 nucleotide binding Molecular Function
KEGG gene cross-reference	ath:AT1G12220 ath:AT4G26090 ath:AT4G27190 ath:AT4G27220 ath:AT5G05400 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.460

Rank 1 · TkA08G279490 · TK1151

Cytoplasm0.417

Rank 2 · TkA08G279490 · TK1151

Cell membrane0.209

Rank 3 · TkA08G279490 · TK1151

Endoplasmic reticulum0.055

Rank 4 · TkA08G279490 · TK1151

Mitochondrion0.033

Rank 5 · TkA08G279490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25013LRR_Zer-15-25 aa

PF13855LRR_85-20 aa

PF23247LRR_RPS213-112 aa

PF23952LRR_EndoS41-64 aa

PF13855LRR_844-52 aa

PF00560LRR_163-78 aa

PF23952LRR_EndoS72-121 aa

PF21999IMS_HHH_172-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G279490	`PF25013`	LRR_Zer-1	5	25	0.037	14.9
TkA08G279490	`PF13855`	LRR_8	5	20	0.2	12.2
TkA08G279490	`PF23247`	LRR_RPS2	13	112	1.2e-48	165.8
TkA08G279490	`PF23952`	LRR_EndoS	41	64	2.7e-07	31.5
TkA08G279490	`PF13855`	LRR_8	44	52	0.2	12.2
TkA08G279490	`PF00560`	LRR_1	63	78	0.88	10.7
TkA08G279490	`PF23952`	LRR_EndoS	72	121	2.7e-07	31.5
TkA08G279490	`PF21999`	IMS_HHH_1	72	86	0.28	12.4
TkA08G279490	`PF23247`	LRR_RPS2	73	174	1.2e-48	165.8
TkA08G279490	`PF25019`	LRR_R13L1-DRL21	73	111	0.00028	21.5
TkA08G279490	`PF25013`	LRR_Zer-1	73	118	0.037	14.9
TkA08G279490	`PF13855`	LRR_8	91	91	0.2	12.2
TkA08G279490	`PF25013`	LRR_Zer-1	101	151	0.037	14.9
TkA08G279490	`PF00560`	LRR_1	103	114	0.88	10.7
TkA08G279490	`PF21999`	IMS_HHH_1	104	121	0.28	12.4
TkA08G279490	`PF23247`	LRR_RPS2	133	227	1.2e-48	165.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card