TkA08G244320 | RubberDandelionOmics

Gene overview

TkA08G244320

Reference: TK1151 Chr: Chr08 Coordinates: 63866088-63866477 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

390 bp · TkA08G244320|TK1151|cDNA

TCCGATATTTTACACAGAGAACTCAATTGGTTAATCGAAGACACTCTAGAAAACCTTAAATCGTTACTGCTTTCTGAACAGGACTCCGTTTTGAAATTACGAGCTGAATTGGGCGATTTGTACTCGTTATGGAAGCAACGAATTGAAAAGAGAAGACCTTTCCAGTACATTGTGGGATGCGAGCATTGGAGGGATTTGGTATTGAGTGTTAAAGAAGGGGTTTTGATTCCACGGCCTGAAACCGAATTGATATTCGATTT...

CDS

Download CDS FASTA

390 bp · TkA08G244320|TK1151|CDS

TCCGATATTTTACACAGAGAACTCAATTGGTTAATCGAAGACACTCTAGAAAACCTTAAATCGTTACTGCTTTCTGAACAGGACTCCGTTTTGAAATTACGAGCTGAATTGGGCGATTTGTACTCGTTATGGAAGCAACGAATTGAAAAGAGAAGACCTTTCCAGTACATTGTGGGATGCGAGCATTGGAGGGATTTGGTATTGAGTGTTAAAGAAGGGGTTTTGATTCCACGGCCTGAAACCGAATTGATATTCGATTT...

Protein

Download Protein FASTA

129 aa · TkA08G244320|TK1151|PROTEIN

SDILHRELNWLIEDTLENLKSLLLSEQDSVLKLRAELGDLYSLWKQRIEKRRPFQYIVGCEHWRDLVLSVKEGVLIPRPETELIFDLVDDAIKQNDELKNGMWVDLGTGSGALAIGIGRILGDFGRIFL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G244320`
TK1151 ID	TkA08G244320
OH-1004 ID	LXL04_037218
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.300
Protein coverage (%)	TK1151 98.450 / OH-1004 32.316 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G244320`
Location	Chr08:63866088-63866477 (-)
Description	Similar to prmC: Release factor glutamine methyltransferase (Thermosynechococcus elongatus (strain BP-1)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037218` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006415 translational termination Biological Process GO:0032259 methylation Biological Process GO:0003676 nucleic acid binding Molecular Function GO:0036009 protein-glutamine N-methyltransferase activity Molecular Function GO:0102559 peptide chain release factor N(5)-glutamine methyltransferase activity Molecular Function
KEGG gene cross-reference	gvi:glr1755 mta:Moth_2396 pma:Pro_0359 syn:sll1237 tel:tlr1836 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.615

Rank 1 · TkA08G244320 · TK1151

Nucleus0.406

Rank 2 · TkA08G244320 · TK1151

Mitochondrion0.081

Rank 3 · TkA08G244320 · TK1151

Peroxisome0.071

Rank 4 · TkA08G244320 · TK1151

Plastid0.069

Rank 5 · TkA08G244320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17827PrmC_N10-59 aa

PF06325PrmA81-117 aa

PF08704GCD1483-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G244320	`PF17827`	PrmC_N	10	59	0.21	12.9
TkA08G244320	`PF06325`	PrmA	81	117	0.28	11.3
TkA08G244320	`PF08704`	GCD14	83	128	0.32	11.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card