TkA08G239750 | RubberDandelionOmics

Gene overview

TkA08G239750

Reference: TK1151 Chr: Chr08 Coordinates: 62465081-62467201 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1014 bp · TkA08G239750|TK1151|cDNA

AAAAAATACAAAAATAACTTAGCTTAGGAAAGCATGTATTTTTCATTTCAAACTCGAAGCAATGCATTAACCTCGTCCATTACTTGAACATTCAAGTCTGGTCGGATTAAAATTATCAAACTGTAGGTGTAGGCTAAACGCCGACCCAACTCTCACCCATAAATTGAGCTTGTGACGTTAGAAATTGGGTCCGATCAGGCTTTTCAAAACCCGGATAGGCTGAAGTCATTAGACGGCGACAGTCTGCATTTCAATTTCAA...

CDS

Download CDS FASTA

711 bp · TkA08G239750|TK1151|CDS

ATGGAATCGAGAGATCATTTGAGCAAATACAAAGTCGGCTCAGTTCCAACTTTGTACTACATCCCGGACTTCATCTCCGATTCCGATCAAAAACTTCTCCTAAATTATATTTACGCAGCTCCGGTTTCAAAATGGAAGTCTCTGAAAAACAGGAGATTGCAAAATTGGGGAGGGATTGTCCATGAAAAGGGTCTTTTGCCTCAAGATTTACCACCATGGCTGACAAAAATTACAGAAAAAATCAACAAGGAATTGCAATT...

Protein

Download Protein FASTA

237 aa · TkA08G239750|TK1151|PROTEIN

MESRDHLSKYKVGSVPTLYYIPDFISDSDQKLLLNYIYAAPVSKWKSLKNRRLQNWGGIVHEKGLLPQDLPPWLTKITEKINKELQLFHSPINHVLINEYLPNQGIMAHQDGPAYFPVVAILSLGSPVIMDFTPHSSIADSTSNIQETNHGNLQNYPPFSIALMPCSLLVFKDMAYSDYLHAIKDSEIQQYDTAVNASEVENDDGDLKVIHRSATRVSLTCRVVSKVHKNLFRKSVV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G239750`
TK1151 ID	TkA08G239750
OH-1004 ID	LXL04_033185
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 98.312 / OH-1004 99.573 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G239750

Location Chr08:62465081-62467201 (+)

Description Similar to Alkbh6: Alpha-ketoglutarate-dependent dioxygenase alkB homolog 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g20350`	May act as an RNA demethylase that binds m⁶A- or m⁵C-modified RNA and participates in removal of these modifications.	Functional Characterization of a Putative RNA Demethylase ALKBH6 in Arabidopsis Growth and Abiotic Stress Responses.2020 · DOI: 10.3390/ijms21186707

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033185 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006950 response to stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:1902584 positive regulation of response to water deprivation Biological Process

GO:1905614 negative regulation of developmental vegetative growth Biological Process

GO:1905615 positive regulation of developmental vegetative growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT4G20350

dre:317736

hsa:84964

mmu:233065

xla:495973

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.636

Rank 1 · TkA08G239750 · TK1151

Cytoplasm0.525

Rank 2 · TkA08G239750 · TK1151

Mitochondrion0.061

Rank 3 · TkA08G239750 · TK1151

Cell membrane0.033

Rank 4 · TkA08G239750 · TK1151

Endoplasmic reticulum0.028

Rank 5 · TkA08G239750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23613ELP3_N7-42 aa

PF135322OG-FeII_Oxy_218-38 aa

PF135322OG-FeII_Oxy_256-222 aa

PF23613ELP3_N74-97 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G239750	`PF23613`	ELP3_N	7	42	0.19	12.4
TkA08G239750	`PF13532`	2OG-FeII_Oxy_2	18	38	2.2e-11	45.1
TkA08G239750	`PF13532`	2OG-FeII_Oxy_2	56	222	2.2e-11	45.1
TkA08G239750	`PF23613`	ELP3_N	74	97	0.19	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUP1`	Arabidopsis thaliana	sp\|Q9SUP1\|ALKB6_ARATH Alkylated DNA repair protein ALKBH6 homolog	60.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card