Gene Card
Gene overview
cDNA / CDS / Protein Sequences
321 bp · TkA08G225210|TK1151|cDNA
ATGCTTCGCTTCTTCTCACCCGCTGTCGATGCCATCATCACCACCCAGCTCCTTGAAATTAGGGGTGGCAATTGGGTTGGGTTCGGGTTGACGGGTCGCGGGTTCGCGTGTCAAAATATAGCAATCCAACCCAACCCATATATTTATACGGGTTCACGGGTTGGCGGGTCACGGGTTGGCGGGTTGAAAGCATCAACCCAGACCCAACCCACTAACCCGTTTAGTTATATAGGTTCGCGGGTTAATAAGTCAATTTCGGG...
321 bp · TkA08G225210|TK1151|CDS
ATGCTTCGCTTCTTCTCACCCGCTGTCGATGCCATCATCACCACCCAGCTCCTTGAAATTAGGGGTGGCAATTGGGTTGGGTTCGGGTTGACGGGTCGCGGGTTCGCGTGTCAAAATATAGCAATCCAACCCAACCCATATATTTATACGGGTTCACGGGTTGGCGGGTCACGGGTTGGCGGGTTGAAAGCATCAACCCAGACCCAACCCACTAACCCGTTTAGTTATATAGGTTCGCGGGTTAATAAGTCAATTTCGGG...
Protein
Download Protein FASTA106 aa · TkA08G225210|TK1151|PROTEIN
MLRFFSPAVDAIITTQLLEIRGGNWVGFGLTGRGFACQNIAIQPNPYIYTGSRVGGSRVGGLKASTQTQPTNPFSYIGSRVNKSISGWRVDFGFMGQFQEVSRWGE
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G225210 |
|---|---|
| TK1151 ID | TkA08G225210 |
| OH-1004 ID | LXL04_004828 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 73.200 |
| Protein coverage (%) | TK1151 83.019 / OH-1004 11.138Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G225210 |
|---|---|
| Location | Chr08:58680601-58681015 (-) |
| Description | Similar to BLH1: BEL1-like homeodomain protein 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0009610 response to symbiotic fungus Biological Process GO:0009737 response to abscisic acid Biological Process GO:0010197 polar nucleus fusion Biological Process GO:0010201 response to continuous far red light stimulus by the high-irradiance response system Biological Process GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function GO:0003677 DNA binding Molecular Function |
| KEGG gene cross-reference | ath:AT1G19700 ath:AT1G75410 ath:AT2G16400 ath:AT2G35940 ath:AT4G34610 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.