TkA08G217130 | RubberDandelionOmics

Gene overview

TkA08G217130

Reference: TK1151 Chr: Chr08 Coordinates: 56765773-56769909 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2741 bp · TkA08G217130|TK1151|cDNA

TTCCACTCCTTCCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTATCATTAGCAGTCTGAGTTATGTCTTGAAGACTCATTCTAAAGCCAGCATCAATAAAATAACCCACTCAATATACACATACAAACACTAAAAGACAAATACAATTTGTGATAATATGTTGAACTTATAGCGGTGGACGACGGGTGGCTGTGTTTTGTAGCAAATGGGTGTTGACTCAAAAGCAGGAATCTTGAAATTATTGCCGCAGTTTTCTT...

CDS

Download CDS FASTA

924 bp · TkA08G217130|TK1151|CDS

ATGGCTACTGCTGGGAAAGCTTTCGAGTTCTATCATGAAGCCAATGACTGGTTTTGTAATGCAGGTTTGCCAAGCGATATCATCGTTGCCATAGACAAAGTAAACTTCCATCTTCACAAGTTTCCTCTTTCTTCGAGATGTGGGAAAATAGATAAATTAATCAAAGAAGCTCAAAATACGGACATTACCCTAGAAGACATTCCTGGTGGGACGAATGCGTTCCTGATCGCAGCTAAGTTCTGCTATGGCGTACGTGTAGA...

Protein

Download Protein FASTA

307 aa · TkA08G217130|TK1151|PROTEIN

MATAGKAFEFYHEANDWFCNAGLPSDIIVAIDKVNFHLHKFPLSSRCGKIDKLIKEAQNTDITLEDIPGGTNAFLIAAKFCYGVRVELTPRNIVLVYCVADYLEMFDEYGDDNLFARAENYFHKNVLKNWKDCMVALQSCENFITQADNLQIISKCLNAVSMMACTDPSLFGWPMMMYGRLQSPGGSILWNGINTGARIRSSESDWWFEDVSYLSVPLFVRLMKMMEAKGIRPEKLTGAIMYYSRKYLHGLGRWKGVHTT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G217130`
TK1151 ID	TkA08G217130
OH-1004 ID	LXL04_032970
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 95.114 / OH-1004 47.021 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G217130

Location Chr08:56765773-56769909 (-)

Description Similar to At3g44820: BTB/POZ domain-containing protein At3g44820

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g44820`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At1g30440`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g03250`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g13600`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g64330`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (By similarity).	Arabidopsis NPH3: A NPH1 photoreceptor-interacting protein essential for phototropism.1999 · DOI: 10.1126/science.286.5441.961 RPT2. A signal transducer of the phototropic response in Arabidopsis.2000 · DOI: 10.1105/tpc.12.2.225 RPT2 is a signal transducer involved in phototropic response and stomatal opening by association with phototropin 1 in Arabidopsis thaliana.2004 · DOI: 10.1105/tpc.019901 PHYTOCHROME KINASE SUBSTRATE 1 is a phototropin 1 binding protein required for phototropism.2006 · DOI: 10.1073/pnas.0603799103 The Arabidopsis PHYTOCHROME KINASE SUBSTRATE2 protein is a phototropin signaling element that regulates leaf flattening and leaf positioning.2010 · DOI: 10.1104/pp.109.150441

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032970 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G30440

ath:AT3G44820

ath:AT5G03250

ath:AT5G13600

ath:AT5G66560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.629

Rank 1 · TkA08G217130 · TK1151

Cytoplasm0.318

Rank 2 · TkA08G217130 · TK1151

Cell membrane0.090

Rank 3 · TkA08G217130 · TK1151

Endoplasmic reticulum0.044

Rank 4 · TkA08G217130 · TK1151

Golgi apparatus0.028

Rank 5 · TkA08G217130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00651BTB22-105 aa

PF03000NPH3205-298 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G217130	`PF00651`	BTB	22	105	0.00027	21.8
TkA08G217130	`PF03000`	NPH3	205	298	1.8e-17	64.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYC8`	Arabidopsis thaliana	sp\|Q9FYC8\|Y3482_ARATH BTB/POZ domain-containing protein At3g44820	57.100%	Swiss-Prot	High
`Q9S9Q9`	Arabidopsis thaliana	sp\|Q9S9Q9\|Y1044_ARATH BTB/POZ domain-containing protein At1g30440	45.900%	Swiss-Prot	Medium
`Q9LYW0`	Arabidopsis thaliana	sp\|Q9LYW0\|Y5325_ARATH BTB/POZ domain-containing protein At5g03250	40.500%	Swiss-Prot	Medium
`Q9FNB3`	Arabidopsis thaliana	sp\|Q9FNB3\|Y5360_ARATH Putative BTB/POZ domain-containing protein At5g13600	36.500%	Swiss-Prot	Medium
`Q9FMF5`	Arabidopsis thaliana	sp\|Q9FMF5\|RPT3_ARATH Root phototropism protein 3	37.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card