TkA08G215210 | RubberDandelionOmics

Gene overview

TkA08G215210

Reference: TK1151 Chr: Chr08 Coordinates: 56282293-56283576 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

733 bp · TkA08G215210|TK1151|cDNA

GATCTCTTTTCTTCATCAACTACACCAAACAACACTTTTGATTTTCTCAAAAGCAAATCTGAAGAGACATCAAAATCGTTACAACTTTTGAACTTTCTTTCTCTTGATGAACCATGCAAGCTCGAGGGGAACTCAAGCTCTAGCAAAAAAGTTGAGGAAAATGAAGATGTGTCAGTGGCATTGCATATTGGGCTTGCGGTTCCTAATAGAGATGAGAATCCCCATAACAATAATATCAACGTAATGGAAAATATGCCGGT...

CDS

Download CDS FASTA

366 bp · TkA08G215210|TK1151|CDS

ATGCATATGTGGGGTCATGGATCAGAATACAGAAAGGGGGCAGAGTCGTTGAGGGGAACACAACCACGAGTGATGATAGGGGTGCCCTGCTATTGTTGCGAAGAGGAGTGCAAGAACAACATTAACCATCCAAGGTCAAAGCCTCTCAAGGACTTTAGGACACTCCAAACACATTACAAAGAAAACATGGCACAAAGTGTTTTTCATGTCGAAAGTGCGGAAAGGATTTTGCTGTTAAAGGTGATTGGCGTACACATGAG...

Protein

Download Protein FASTA

122 aa · TkA08G215210|TK1151|PROTEIN

MHMWGHGSEYRKGAESLRGTQPRVMIGVPCYCCEEECKNNINHPRSKPLKDFRTLQTHYKENMAQSVFHVESAERILLLKVIGVHMRRIVGNGGCAFVVLISSIRDHLKTILCHLVLVMLHH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G215210`
TK1151 ID	TkA08G215210
OH-1004 ID	LXL04_032942
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 49.180 / OH-1004 23.166 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G215210

Location Chr08:56282293-56283576 (+)

Description Similar to TT1: Protein TRANSPARENT TESTA 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34790`	May act as a transcriptional regulator involved in the differentiation of young endothelium.	No verified direct reference in this release
`At1g08290`	Probable transcriptional regulator.	No verified direct reference in this release
`At3g20880`	Probable transcriptional regulator.	No verified direct reference in this release
`At1g51220`	Probable transcriptional regulator.	No verified direct reference in this release
`At3g57670`	Transcriptional regulator required for normal differentiation of the ovary transmitting tract cells and pollen tube growth.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032942 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001709 cell fate determination Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010500 transmitting tissue development Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

KEGG gene cross-reference

ath:AT1G08290

ath:AT1G13290

ath:AT1G34790

ath:AT1G51220

ath:AT3G57670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.484

Rank 1 · TkA08G215210 · TK1151

Cytoplasm0.399

Rank 2 · TkA08G215210 · TK1151

Mitochondrion0.098

Rank 3 · TkA08G215210 · TK1151

Cell membrane0.074

Rank 4 · TkA08G215210 · TK1151

Endoplasmic reticulum0.074

Rank 5 · TkA08G215210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23115zf-C2H2_STOP2_3rd30-60 aa

PF23115zf-C2H2_STOP2_3rd108-113 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G215210	`PF23115`	zf-C2H2_STOP2_3rd	30	60	4.8e-15	56.0
TkA08G215210	`PF23115`	zf-C2H2_STOP2_3rd	108	113	4.8e-15	56.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VWG3`	Arabidopsis thaliana	sp\|Q8VWG3\|TT1_ARATH Protein TRANSPARENT TESTA 1	65.000%	Swiss-Prot	Medium
`Q9SGD1`	Arabidopsis thaliana	sp\|Q9SGD1\|ZWIP3_ARATH Zinc finger protein WIP3	64.200%	Swiss-Prot	Medium
`Q8W030`	Arabidopsis thaliana	sp\|Q8W030\|ZWIP4_ARATH Zinc finger protein WIP4	78.300%	Swiss-Prot	Low
`Q8W031`	Arabidopsis thaliana	sp\|Q8W031\|ZWIP5_ARATH Zinc finger protein WIP5	70.600%	Swiss-Prot	Medium
`Q9SVY1`	Arabidopsis thaliana	sp\|Q9SVY1\|ZWIP2_ARATH Zinc finger protein WIP2	78.300%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card