LXL04_032942 | RubberDandelionOmics

Gene overview

LXL04_032942

Reference: OH-1004 Chr: Chr07 Coordinates: 31990927-31992255 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

780 bp · LXL04_032942|LXL04_032942|OH1004|cDNA

ATGGATCTCTTTTCTTCATCAACTACACCAAACAACACTTTTGATTTTCTCAAAAGCAAATCTGAAGAGACATCAAAATCGTTACAACTTTTGAACTTTCTTTCTCTTGATGAACCATGCAAGCTCGAGGGGAACTCAAGCTCTAGCAAAAAAGTTGAGGAAAATGAAGATGTGTCAGTGGCATTGCATATTGGGCTTGCGGTTCCTAATAGAGATGAGAATCCCCATAACAATAATATCAACGTAATGGAAAATATGCC...

CDS

Download CDS FASTA

780 bp · LXL04_032942|LXL04_032942|OH1004|CDS

ATGGATCTCTTTTCTTCATCAACTACACCAAACAACACTTTTGATTTTCTCAAAAGCAAATCTGAAGAGACATCAAAATCGTTACAACTTTTGAACTTTCTTTCTCTTGATGAACCATGCAAGCTCGAGGGGAACTCAAGCTCTAGCAAAAAAGTTGAGGAAAATGAAGATGTGTCAGTGGCATTGCATATTGGGCTTGCGGTTCCTAATAGAGATGAGAATCCCCATAACAATAATATCAACGTAATGGAAAATATGCC...

Protein

Download Protein FASTA

259 aa · LXL04_032942|LXL04_032942|OH1004|PROTEIN

MDLFSSSTTPNNTFDFLKSKSEETSKSLQLLNFLSLDEPCKLEGNSSSSKKVEENEDVSVALHIGLAVPNRDENPHNNNINVMENMPVNVEYWIPSRAQILAGFTHFSCQICNKTFNRYNNLQMHMWGHGSEYRKGAESLRGTQPRVMIGVPCYCCEEECKNNINHPRSKPLKDFRTLQTHYKRKHGTKRFSCRKCGKDFAVKGDWRTHEKNCGKRWLCVCGSDFKHKRSLKDHIMSFGAGHAPSPPSFHAVDLREPIN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032942`
TK1151 ID	TkA08G215210
OH-1004 ID	LXL04_032942
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 49.180 / OH-1004 23.166 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032942

Location Chr07:31990927-31992255 (+)

Description Similar to TT1: Protein TRANSPARENT TESTA 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34790`	May act as a transcriptional regulator involved in the differentiation of young endothelium.	No verified direct reference in this release
`At1g08290`	Probable transcriptional regulator.	No verified direct reference in this release
`At3g57670`	Transcriptional regulator required for normal differentiation of the ovary transmitting tract cells and pollen tube growth.	No verified direct reference in this release
`At1g13290`	Probable transcriptional regulator (Probable).	No verified direct reference in this release
`At1g51220`	Probable transcriptional regulator.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032942 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001709 cell fate determination Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009813 flavonoid biosynthetic process Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0010305 leaf vascular tissue pattern formation Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010500 transmitting tissue development Biological Process

GO:0010588 cotyledon vascular tissue pattern formation Biological Process

GO:0048364 root development Biological Process

GO:0048367 shoot system development Biological Process

KEGG gene cross-reference

ath:AT1G08290

ath:AT1G13290

ath:AT1G34790

ath:AT1G51220

ath:AT3G57670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.975

Rank 1 · LXL04_032942 · OH-1004

Cytoplasm0.084

Rank 2 · LXL04_032942 · OH-1004

Cell membrane0.021

Rank 3 · LXL04_032942 · OH-1004

Endoplasmic reticulum0.012

Rank 4 · LXL04_032942 · OH-1004

Plastid0.009

Rank 5 · LXL04_032942 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00096.33zf-C2H2107-126 aa

PF23115.2zf-C2H2_STOP2_3rd153-187 aa

PF22995.3C2CH-3rd_BIRD-IDD190-214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032942	`PF00096.33`	zf-C2H2	107	126	4.8e-07	30.6
LXL04_032942	`PF23115.2`	zf-C2H2_STOP2_3rd	153	187	4.7e-17	62.4
LXL04_032942	`PF22995.3`	C2CH-3rd_BIRD-IDD	190	214	4.7e-12	46.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VWG3`	Arabidopsis thaliana	Protein TRANSPARENT TESTA 1	67.822%	Swiss-Prot	strong database homology
`Q9SGD1`	Arabidopsis thaliana	Zinc finger protein WIP3	55.094%	Swiss-Prot	strong database homology
`Q9SVY1`	Arabidopsis thaliana	Zinc finger protein WIP2	76.471%	Swiss-Prot	moderate database homology
`Q9FX68`	Arabidopsis thaliana	Zinc finger protein WIP6	65.327%	Swiss-Prot	strong database homology
`Q8W031`	Arabidopsis thaliana	Zinc finger protein WIP5	49.462%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card