TkA08G213110 | RubberDandelionOmics

Gene overview

TkA08G213110

Reference: TK1151 Chr: Chr08 Coordinates: 55755763-55759996 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3849 bp · TkA08G213110|TK1151|cDNA

TTTATATTTGCCCCCTTAACTATTCAAAACCTTCAAGATCTTTCCTAGCATTTGTAACCAGCAATGGCTGTTGAAATGTAATCGCTGGGCTAAAGGCCCAACCTTATACCCCCGTCACCGAGAAGCGATATTCATAGGAAACTTGTGATTCTTCACGAGACTGTGTTTACAAGAAGAACTTGTTGACGAAATATATTTTGTAATCGATTATGAATCACGTTTGGTGAAAATTCTGTGAATTGGATCTGCATACAAGCAAA...

CDS

Download CDS FASTA

3099 bp · TkA08G213110|TK1151|CDS

ATGAGGGTGGCAGGACAATCACCACCACCATCTACTCCGCGACAATCAACACCGTCGTCTCCGTCCACATTAACAGCAAAAGATGCGGAATCTCTCTTCCGTACCAAACCTATATCCGAAATCCGAAATGTCGAAGCTGCAACCCGAAAACAGATCCAGGATAAGAGCGAAGAGCTCCGGCAACTTGTCGGCAACCGTTACCGCGATCTGATCGATTCCGCCGATTCAATCGTCAACATGAAGTCATCTTGCCACTCCAT...

Protein

Download Protein FASTA

1032 aa · TkA08G213110|TK1151|PROTEIN

MRVAGQSPPPSTPRQSTPSSPSTLTAKDAESLFRTKPISEIRNVEAATRKQIQDKSEELRQLVGNRYRDLIDSADSIVNMKSSCHSISANISSVHDGIIHSLSSTTINPNSASSNPARARIYGIACRVKYIVDTPENIWGCLDESMFVDAAARYMRAKLVHHGLTSNDKNKSVLLKFPLLQHQWQIVESFKTQISQRSRERLLLDQAVGLEISAYADALAAVSVIDELNPSQVLKLLLDSRKSCVSQKLGSCKAVSEDVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G213110`
TK1151 ID	TkA08G213110
OH-1004 ID	LXL04_032910
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G213110

Location Chr08:55755763-55759996 (+)

Description Similar to COG1: Conserved oligomeric Golgi complex subunit 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16300`	Required for normal Golgi function.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032910 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000301 retrograde transport, vesicle recycling within Golgi Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0007030 Golgi organization Biological Process

GO:0015031 protein transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0009536 plastid Cellular Component

GO:0017119 Golgi transport complex Cellular Component

GO:0032588 trans-Golgi network membrane Cellular Component

KEGG gene cross-reference

ath:AT5G16300

ddi:DDB_G0277691

hsa:9382

mmu:16834

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.518

Rank 1 · TkA08G213110 · TK1151

Golgi apparatus0.313

Rank 2 · TkA08G213110 · TK1151

Nucleus0.189

Rank 3 · TkA08G213110 · TK1151

Lysosome / Vacuole0.142

Rank 4 · TkA08G213110 · TK1151

Endoplasmic reticulum0.098

Rank 5 · TkA08G213110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08700VPS51_Exo84_N27-96 aa

PF20651EXOC6_Sec15_N51-104 aa

PF20651EXOC6_Sec15_N253-281 aa

PF08700VPS51_Exo84_N561-582 aa

PF07093SGT1671-744 aa

PF20651EXOC6_Sec15_N687-712 aa

PF07093SGT1813-888 aa

PF08700VPS51_Exo84_N852-876 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G213110	`PF08700`	VPS51_Exo84_N	27	96	8e-17	61.8
TkA08G213110	`PF20651`	EXOC6_Sec15_N	51	104	0.54	10.9
TkA08G213110	`PF20651`	EXOC6_Sec15_N	253	281	0.54	10.9
TkA08G213110	`PF08700`	VPS51_Exo84_N	561	582	8e-17	61.8
TkA08G213110	`PF07093`	SGT1	671	744	0.38	9.9
TkA08G213110	`PF20651`	EXOC6_Sec15_N	687	712	0.54	10.9
TkA08G213110	`PF07093`	SGT1	813	888	0.38	9.9
TkA08G213110	`PF08700`	VPS51_Exo84_N	852	876	8e-17	61.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FFF3`	Arabidopsis thaliana	sp\|Q9FFF3\|COG1_ARATH Conserved oligomeric Golgi complex subunit 1	59.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card