Gene Card
Gene overview
cDNA / CDS / Protein Sequences
330 bp · TkA08G208850|TK1151|cDNA
ATGGCAGTTAGAAACACCAAAGCAGTCCATGACCAGATCCAGAAGTGGCAAGATGAATGGTCTGGAAGGGGCCTTCCTCTCAATATCGAGGTCTTGGAACTGGACCTTCTTTCCTTGGATTCTGTTGTAAGGTTTGCAAAGGCATGGAATGCACGATTAGGACCTTTACATGTCCTCATCAACAATGCAGGGATATTTTCCATTGGAGAACCACAAAAGTTTTCAAAAGATGGATATGAAGAACACATGCAAGTGAACCA...
330 bp · TkA08G208850|TK1151|CDS
ATGGCAGTTAGAAACACCAAAGCAGTCCATGACCAGATCCAGAAGTGGCAAGATGAATGGTCTGGAAGGGGCCTTCCTCTCAATATCGAGGTCTTGGAACTGGACCTTCTTTCCTTGGATTCTGTTGTAAGGTTTGCAAAGGCATGGAATGCACGATTAGGACCTTTACATGTCCTCATCAACAATGCAGGGATATTTTCCATTGGAGAACCACAAAAGTTTTCAAAAGATGGATATGAAGAACACATGCAAGTGAACCA...
Protein
Download Protein FASTA109 aa · TkA08G208850|TK1151|PROTEIN
MAVRNTKAVHDQIQKWQDEWSGRGLPLNIEVLELDLLSLDSVVRFAKAWNARLGPLHVLINNAGIFSIGEPQKFSKDGYEEHMQVNHLAPALLSVLLLHHLSEVPLVEL
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA08G208850 |
|---|---|
| TK1151 ID | TkA08G208850 |
| OH-1004 ID | LXL04_035530 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 79.600 |
| Protein coverage (%) | TK1151 89.908 / OH-1004 25.455Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA08G208850 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr08:54612417-54612901 (+) | |||||||||
| Description | Similar to FEY: Dehydrogenase/reductase SDR family member FEY | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0001523 retinoid metabolic process Biological Process GO:0010073 meristem maintenance Biological Process GO:0016055 Wnt signaling pathway Biological Process GO:0030178 negative regulation of Wnt signaling pathway Biological Process GO:0042572 retinol metabolic process Biological Process GO:0042574 retinal metabolic process Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0071560 cellular response to transforming growth factor beta stimulus Biological Process GO:0110095 cellular detoxification of aldehyde Biological Process GO:2000024 regulation of leaf development Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT4G27760 hsa:51109 hsa:51741 mmu:80707 pon:100172779 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08659KR8-85 aaPF00106adh_short27-102 aaPF13561adh_short_C229-97 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA08G208850 | PF08659 | KR | 8 | 85 | 0.11 | 13.1 |
| TkA08G208850 | PF00106 | adh_short | 27 | 102 | 5e-09 | 36.7 |
| TkA08G208850 | PF13561 | adh_short_C2 | 29 | 97 | 3.7e-05 | 24.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.