TkA08G204990 | RubberDandelionOmics

Gene overview

TkA08G204990

Reference: TK1151 Chr: Chr08 Coordinates: 53565435-53565884 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

450 bp · TkA08G204990|TK1151|cDNA

ATGCGAAGATTGAAGATCTGTGTTGGAATTGCACACGCATTGAGTTACATTCATTACGATGATGGACGTGATTTTAGCGTCATACATTGTGATACCAGGAGCTCAAAGATCTTGCTAGACGACGACCGGGAAGCAAAACTGTCTGGATTTGAACTTTCAATGAAGCAGACGGCAAATCAAAGGAACGGTCTTTTCTTTACCGATGTCTGTGGCACGTATGGGTACCGTGACCCGACGTATAATCAGAGTGGAAGTGTGAC...

CDS

Download CDS FASTA

450 bp · TkA08G204990|TK1151|CDS

ATGCGAAGATTGAAGATCTGTGTTGGAATTGCACACGCATTGAGTTACATTCATTACGATGATGGACGTGATTTTAGCGTCATACATTGTGATACCAGGAGCTCAAAGATCTTGCTAGACGACGACCGGGAAGCAAAACTGTCTGGATTTGAACTTTCAATGAAGCAGACGGCAAATCAAAGGAACGGTCTTTTCTTTACCGATGTCTGTGGCACGTATGGGTACCGTGACCCGACGTATAATCAGAGTGGAAGTGTGAC...

Protein

Download Protein FASTA

149 aa · TkA08G204990|TK1151|PROTEIN

MRRLKICVGIAHALSYIHYDDGRDFSVIHCDTRSSKILLDDDREAKLSGFELSMKQTANQRNGLFFTDVCGTYGYRDPTYNQSGSVTHKADMYSFGVVLFEVLCRKKAVMVEKNNRLLAPVVISEYEGGRLNVGPGFRLFKRWAGKKLG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G204990`
TK1151 ID	TkA08G204990
OH-1004 ID	LXL04_032791
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 58.203 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G204990

Location Chr08:53565435-53565884 (+)

Description Similar to ANX1: Receptor-like protein kinase ANXUR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26330`	May act as a receptor kinase with ERL1 and ERL2 to regulate shoot architecture and stomatal patterning.	KNAT1 and ERECTA regulate inflorescence architecture in Arabidopsis.2002 · DOI: 10.1105/tpc.010391 Novel as1 and as2 defects in leaf adaxial-abaxial polarity reveal the requirement for ASYMMETRIC LEAVES1 and 2 and ERECTA functions in specifying leaf adaxial identity.2003 · DOI: 10.1242/dev.00622 ERECTA, an LRR receptor-like kinase protein controlling development pleiotropically affects resistance to bacterial wilt.2003 · DOI: 10.1046/j.1365-313x.2003.01877.x Synergistic interaction of three ERECTA-family receptor-like kinases controls Arabidopsis organ growth and flower development by promoting cell proliferation.2004 · DOI: 10.1242/dev.01028 ERECTA is required for protection against heat-stress in the AS1/ AS2 pathway to regulate adaxial-abaxial leaf polarity in Arabidopsis.2004 · DOI: 10.1007/s00425-004-1248-z ERECTA receptor-like kinase and heterotrimeric G protein from Arabidopsis are required for resistance to the necrotrophic fungus Plectosphaerella cucumerina.2005 · DOI: 10.1111/j.1365-313x.2005.02440.x The ERECTA gene regulates plant transpiration efficiency in Arabidopsis.2005 · DOI: 10.1038/nature03835 Pedicel development in Arabidopsis thaliana: contribution of vascular positioning and the role of the BREVIPEDICELLUS and ERECTA genes.2005 · DOI: 10.1016/j.ydbio.2005.06.011 Interaction of auxin and ERECTA in elaborating Arabidopsis inflorescence architecture revealed by the activation tagging of a new member of the YUCCA family putative flavin monooxygenases.2005 · DOI: 10.1104/pp.105.063495 ABA is an essential signal for plant resistance to pathogens affecting JA biosynthesis and the activation of defenses in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048041 Haploinsufficiency after successive loss of signaling reveals a role for ERECTA-family genes in Arabidopsis ovule development.2007 · DOI: 10.1242/dev.004788 Genetics of microenvironmental canalization in Arabidopsis thaliana.2007 · DOI: 10.1073/pnas.0701936104 A strong effect of growth medium and organ type on the identification of QTLs for phytate and mineral concentrations in three Arabidopsis thaliana RIL populations.2009 · DOI: 10.1093/jxb/erp084 Polymorphic genes of major effect: consequences for variation, selection and evolution in Arabidopsis thaliana.2009 · DOI: 10.1534/genetics.108.097030 The ERECTA Receptor-Like Kinase Regulates Cell Wall-Mediated Resistance to Pathogens in Arabidopsis thaliana.2009 · DOI: 10.1094/mpmi-22-8-0953 Direct interaction of ligand-receptor pairs specifying stomatal patterning.2012 · DOI: 10.1101/gad.179895.111 Regulation of inflorescence architecture by intertissue layer ligand-receptor communication between endodermis and phloem.2012 · DOI: 10.1073/pnas.1117537109 Regulation of plant vascular stem cells by endodermis-derived EPFL-family peptide hormones and phloem-expressed ERECTA-family receptor kinases.2013 · DOI: 10.1093/jxb/ert196 A receptor-like protein acts as a specificity switch for the regulation of stomatal development.2017 · DOI: 10.1101/gad.297580.117 The Arabidopsis ERECTA gene encodes a putative receptor protein kinase with extracellular leucine-rich repeats.1996 · DOI: 10.1105/tpc.8.4.735
`At5g62230`	Receptor kinase that regulates inflorescence architecture and organ shape as well as stomatal patterning, including density and clustering, together with ER and ERL2.	Synergistic interaction of three ERECTA-family receptor-like kinases controls Arabidopsis organ growth and flower development by promoting cell proliferation.2004 · DOI: 10.1242/dev.01028 Haploinsufficiency after successive loss of signaling reveals a role for ERECTA-family genes in Arabidopsis ovule development.2007 · DOI: 10.1242/dev.004788 Direct interaction of ligand-receptor pairs specifying stomatal patterning.2012 · DOI: 10.1101/gad.179895.111 Regulation of plant vascular stem cells by endodermis-derived EPFL-family peptide hormones and phloem-expressed ERECTA-family receptor kinases.2013 · DOI: 10.1093/jxb/ert196 A receptor-like protein acts as a specificity switch for the regulation of stomatal development.2017 · DOI: 10.1101/gad.297580.117
`At5g07180`	Receptor kinase that regulates inflorescence architecture and organ shape as well as stomatal patterning, including density and clustering, together with ERL1 and ER.	Synergistic interaction of three ERECTA-family receptor-like kinases controls Arabidopsis organ growth and flower development by promoting cell proliferation.2004 · DOI: 10.1242/dev.01028 Haploinsufficiency after successive loss of signaling reveals a role for ERECTA-family genes in Arabidopsis ovule development.2007 · DOI: 10.1242/dev.004788
`At2g30730`	Receptor-like cytoplasmic kinase (RLCK) that triggers abscisic acid (ABA) signaling in response to dehydration by phosphorylating and activating ABA receptors to support their monomerization and enhance their ABA binding affinity; they in turn repress PP2C protein phosphatases acting as negative regulators of ABA responses (By similarity).	Catalytically inactive subgroup VIII receptor-like cytoplasmic kinases regulate the immune-triggered oxidative burst in Arabidopsis thaliana.2025 · DOI: 10.1093/jxb/erae486
`At1g76370`	May be involved in plant defense signaling.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032791 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010038 response to metal ion Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0043680 filiform apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G23200

ath:AT3G04690

ath:AT3G46290

ath:AT5G28680

ath:AT5G39000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.512

Rank 1 · TkA08G204990 · TK1151

Nucleus0.280

Rank 2 · TkA08G204990 · TK1151

Cell membrane0.203

Rank 3 · TkA08G204990 · TK1151

Endoplasmic reticulum0.108

Rank 4 · TkA08G204990 · TK1151

Lysosome / Vacuole0.048

Rank 5 · TkA08G204990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr3-116 aa

PF00069Pkinase5-115 aa

PF30270AlyA59-112 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G204990	`PF07714`	PK_Tyr_Ser-Thr	3	116	9.6e-11	42.2
TkA08G204990	`PF00069`	Pkinase	5	115	2.9e-16	60.4
TkA08G204990	`PF30270`	AlyA	59	112	0.12	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q42371`	Arabidopsis thaliana	sp\|Q42371\|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA	43.800%	Swiss-Prot	Medium
`C0LGW6`	Arabidopsis thaliana	sp\|C0LGW6\|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1	45.500%	Swiss-Prot	Medium
`Q6XAT2`	Arabidopsis thaliana	sp\|Q6XAT2\|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2	45.500%	Swiss-Prot	Medium
`O49338`	Arabidopsis thaliana	sp\|O49338\|CARK9_ARATH Protein CYTOSOLIC ABA RECEPTOR KINASE 9	45.800%	Swiss-Prot	Medium
`Q9SFX0`	Arabidopsis thaliana	sp\|Q9SFX0\|PBL22_ARATH Probable serine/threonine-protein kinase PBL22	43.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card