TkA08G203980 | RubberDandelionOmics

Gene overview

TkA08G203980

Reference: TK1151 Chr: Chr08 Coordinates: 53342104-53344582 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1568 bp · TkA08G203980|TK1151|cDNA

TCGAATATAAAAAAGCACTGCTTTCGCCTGAGCTTCAACCCCATCAGAACCATTCTTCCAAGTTTCTTCCGGCGCTCCTCCGACGGTTCTTCCGGCATTCGGCCCACCGGCGCTCCTCCGACGCTCTGCTCCTCGACGCTCTGCAGCTCCCCTCTTCCTGGCGACGCCGACGTGACCTGCGGGCTGCGGCCCTCTTCCTTCCTTTCTTCCTGGCGACGCCGACCAGGTTTGTTCCAGCTTGATCTAGAAATGGCTCATCT...

CDS

Download CDS FASTA

1251 bp · TkA08G203980|TK1151|CDS

TCGAATATAAAAAAGCACTGCTTTCGCCTGAGCTTCAACCCCATCAGAACCATTCTTCCAAGTTTCTTCCGGCGCTCCTCCGACGGTTCTTCCGGCATTCGGCCCACCGGCGCTCCTCCGACGCTCTGCTCCTCGACGCTCTGCAGCTCCCCTCTTCCTGGCGACGCCGACGTGACCTGCGGGCTGCGGCCCTCTTCCTTCCTTTCTTCCTGGCGACGCCGACCAGGTTTGTTCCAGCTTGATCTAGAAATGGCTCATCT...

Protein

Download Protein FASTA

416 aa · TkA08G203980|TK1151|PROTEIN

SNIKKHCFRLSFNPIRTILPSFFRRSSDGSSGIRPTGAPPTLCSSTLCSSPLPGDADVTCGLRPSSFLSSWRRRPGLFQLDLEMAHLYKSRLQNHAQKKNIAFPVYACEMQGPPHSRLFKARVTIDGATFEGPEFCSTLKDAEHAAAKVAFMALSPDGTQEDDSLYKSLLQEHAQKKGLPLPVYATNRTGQPHIPSFASTVEIAGECYMGQEARTKKQAEINAAKVAFMALTEGEKKTNNAAVFSDIHIVGPSISGSSKT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G203980`
TK1151 ID	TkA08G203980
OH-1004 ID	LXL04_033551
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	93.400
Protein coverage (%)	TK1151 29.327 / OH-1004 95.312 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G203980

Location Chr08:53342104-53344582 (-)

Description Similar to DBR4: Double-stranded RNA-binding protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62800`	Double-stranded RNA-binding protein involved in RNA-mediated post-transcriptional gene silencing (PTGS).	No verified direct reference in this release
`At3g26932`	Binds double-stranded RNA.	No verified direct reference in this release
`At2g28380`	Binds double-stranded RNA.	Specific interactions between Dicer-like proteins and HYL1/DRB-family dsRNA-binding proteins in Arabidopsis thaliana.2005 · DOI: 10.1007/s11103-004-6853-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0508500`	Binds double-stranded RNA.	No verified direct reference in this release
`Os01g0772000`	Binds double-stranded RNA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033551 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009616 RNAi-mediated antiviral immune response Biological Process

GO:0010267 ta-siRNA processing Biological Process

GO:0035196 miRNA processing Biological Process

GO:0051607 defense response to virus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003725 double-stranded RNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G28380

ath:AT3G26932

ath:AT3G62800

dosa:Os05g0150400

dosa:Os09g0508500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.690

Rank 1 · TkA08G203980 · TK1151

Cytoplasm0.319

Rank 2 · TkA08G203980 · TK1151

Cell membrane0.081

Rank 3 · TkA08G203980 · TK1151

Endoplasmic reticulum0.078

Rank 4 · TkA08G203980 · TK1151

Mitochondrion0.026

Rank 5 · TkA08G203980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00035dsrm88-151 aa

PF14709DND1_DSRM90-154 aa

PF14954LIX1113-152 aa

PF27883PPI_C140-153 aa

PF00035dsrm166-228 aa

PF14709DND1_DSRM167-231 aa

PF14954LIX1199-233 aa

PF27883PPI_C214-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G203980	`PF00035`	dsrm	88	151	7.8e-28	97.6
TkA08G203980	`PF14709`	DND1_DSRM	90	154	2.4e-08	34.9
TkA08G203980	`PF14954`	LIX1	113	152	0.0043	17.1
TkA08G203980	`PF27883`	PPI_C	140	153	1.4	9.8
TkA08G203980	`PF00035`	dsrm	166	228	7.8e-28	97.6
TkA08G203980	`PF14709`	DND1_DSRM	167	231	2.4e-08	34.9
TkA08G203980	`PF14954`	LIX1	199	233	0.0043	17.1
TkA08G203980	`PF27883`	PPI_C	214	237	1.4	9.8
TkA08G203980	`PF00035`	dsrm	242	267	7.8e-28	97.6
TkA08G203980	`PF00035`	dsrm	353	362	7.8e-28	97.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1D4`	Arabidopsis thaliana	sp\|Q8H1D4\|DRB4_ARATH Double-stranded RNA-binding protein 4	52.300%	Swiss-Prot	Low
`Q9LJF5`	Arabidopsis thaliana	sp\|Q9LJF5\|DRB3_ARATH Double-stranded RNA-binding protein 3	47.100%	Swiss-Prot	Low
`Q9SKN2`	Arabidopsis thaliana	sp\|Q9SKN2\|DRB2_ARATH Double-stranded RNA-binding protein 2	44.800%	Swiss-Prot	Low
`B7E321`	Oryza sativa subsp. japonica	sp\|B7E321\|DRB5_ORYSJ Double-stranded RNA-binding protein 5	44.400%	Swiss-Prot	Low
`Q5N8Z0`	Oryza sativa subsp. japonica	sp\|Q5N8Z0\|DRB1_ORYSJ Double-stranded RNA-binding protein 1	43.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card