LXL04_033551 | RubberDandelionOmics

Gene overview

LXL04_033551

Reference: OH-1004 Chr: Chr07 Coordinates: 47536263-47536729 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

387 bp · LXL04_033551|LXL04_033551|OH1004|cDNA

ATGGCTCATCTATACAAGAGTAGACTCCAAAACCACGTCCAAAAGAAGAACATTGCTTTCCATGTGTACACTTGTGAGATGCAAGGTCCTCCACATTCCCGTCTCTTTAAAGCATGTGTCACCATTGATGGAGCTACATTCAAGGGACCTGAATTTTGCAGCACACTGAAAGATGCAGAACACGCAGCTGCTAAAGTTGCTTTCATGGCATTATCACCAGATGGAACGCAAGAAGATGACTCTTTATACAAGAGTCTTTT...

CDS

Download CDS FASTA

387 bp · LXL04_033551|LXL04_033551|OH1004|CDS

ATGGCTCATCTATACAAGAGTAGACTCCAAAACCACGTCCAAAAGAAGAACATTGCTTTCCATGTGTACACTTGTGAGATGCAAGGTCCTCCACATTCCCGTCTCTTTAAAGCATGTGTCACCATTGATGGAGCTACATTCAAGGGACCTGAATTTTGCAGCACACTGAAAGATGCAGAACACGCAGCTGCTAAAGTTGCTTTCATGGCATTATCACCAGATGGAACGCAAGAAGATGACTCTTTATACAAGAGTCTTTT...

Protein

Download Protein FASTA

128 aa · LXL04_033551|LXL04_033551|OH1004|PROTEIN

MAHLYKSRLQNHVQKKNIAFHVYTCEMQGPPHSRLFKACVTIDGATFKGPEFCSTLKDAEHAAAKVAFMALSPDGTQEDDSLYKSLLQEHSQKKGLPLPVYATNRTAQPHIPSFASTVEIGGFILTIF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033551`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033551

Location Chr07:47536263-47536729 (+)

Description Similar to DBR4: Double-stranded RNA-binding protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62800`	Double-stranded RNA-binding protein involved in RNA-mediated post-transcriptional gene silencing (PTGS).	No verified direct reference in this release
`At3g26932`	Binds double-stranded RNA.	No verified direct reference in this release
`At2g28380`	Binds double-stranded RNA.	Specific interactions between Dicer-like proteins and HYL1/DRB-family dsRNA-binding proteins in Arabidopsis thaliana.2005 · DOI: 10.1007/s11103-004-6853-5

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0508500`	Binds double-stranded RNA.	No verified direct reference in this release
`Os05g0150400`	Binds double-stranded RNA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033551 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009616 RNAi-mediated antiviral immune response Biological Process

GO:0010267 ta-siRNA processing Biological Process

GO:0035196 miRNA processing Biological Process

GO:0051607 defense response to virus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003725 double-stranded RNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G28380

ath:AT3G26932

ath:AT3G62800

dosa:Os05g0150400

dosa:Os09g0508500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.580

Rank 1 · LXL04_033551 · OH-1004

Nucleus0.544

Rank 2 · LXL04_033551 · OH-1004

Mitochondrion0.065

Rank 3 · LXL04_033551 · OH-1004

Extracellular0.059

Rank 4 · LXL04_033551 · OH-1004

Endoplasmic reticulum0.054

Rank 5 · LXL04_033551 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00035.33dsrm5-68 aa

PF00035.33dsrm83-126 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033551	`PF00035.33`	dsrm	5	68	1.5e-21	77.4
LXL04_033551	`PF00035.33`	dsrm	83	126	1.5e-21	77.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1D4`	Arabidopsis thaliana	Double-stranded RNA-binding protein 4	45.238%	Swiss-Prot	moderate database homology
`Q9LJF5`	Arabidopsis thaliana	Double-stranded RNA-binding protein 3	42.188%	Swiss-Prot	moderate database homology
`Q9SKN2`	Arabidopsis thaliana	Double-stranded RNA-binding protein 2	41.985%	Swiss-Prot	moderate database homology
`B7E321`	Oryza sativa subsp. japonica	Double-stranded RNA-binding protein 5	44.094%	Swiss-Prot	moderate database homology
`Q0DKP4`	Oryza sativa subsp. japonica	Double-stranded RNA-binding protein 2	42.748%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card