TkA08G203130 | RubberDandelionOmics

Gene overview

TkA08G203130

Reference: TK1151 Chr: Chr08 Coordinates: 53096262-53099376 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2483 bp · TkA08G203130|TK1151|cDNA

CACACATAGAAACATGGTATTTAACATAACCTCGGTTAAGACATCATCAGATGGAGTGTGGCAAGGCAATAACCCTCTTCACTATGCATTTCCATTGTTGATACTTCAAACTACAATGGTTATCTTTATCAGTAGATTGCTCGCATTTTTCCTCAAACCTCTTCGACAACCTAAAGTCATCGCAGAGATACTCGGTGGAATTCTACTAGGGCCATCGGGTTTAGGCAGGAACAAGGAATTTATGCTATGGGTTTTCCCGT...

CDS

Download CDS FASTA

2316 bp · TkA08G203130|TK1151|CDS

ATGGTATTTAACATAACCTCGGTTAAGACATCATCAGATGGAGTGTGGCAAGGCAATAACCCTCTTCACTATGCATTTCCATTGTTGATACTTCAAACTACAATGGTTATCTTTATCAGTAGATTGCTCGCATTTTTCCTCAAACCTCTTCGACAACCTAAAGTCATCGCAGAGATACTCGGTGGAATTCTACTAGGGCCATCGGGTTTAGGCAGGAACAAGGAATTTATGCTATGGGTTTTCCCGTCATGGAGCACGCC...

Protein

Download Protein FASTA

771 aa · TkA08G203130|TK1151|PROTEIN

MVFNITSVKTSSDGVWQGNNPLHYAFPLLILQTTMVIFISRLLAFFLKPLRQPKVIAEILGGILLGPSGLGRNKEFMLWVFPSWSTPILETVASIGLLFFLFLVGLELDLISIRRSGKKALAIASAGILLPFVFGVGITVLLLKAVSGADKVGYIQCFLFMGVSLSITAFPVLARILAELKLLTTSVGETAMAAAAFNDIAAWVLLALAVALAGGSHQNLLASLWVLLSGVGFVIFMVVVVRPTMDRIATRCSNHGQVEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G203130`
TK1151 ID	TkA08G203130
OH-1004 ID	LXL04_032748
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 94.458 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G203130

Location Chr08:53096262-53099376 (-)

Description Similar to CHX20: Cation/H(+) antiporter 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53720`	May act as a K⁺/H⁺ antiporter that maintains guard-cell K⁺ homeostasis and regulates pH.	Participation of endomembrane cation/H+ exchanger AtCHX20 in osmoregulation of guard cells.2007 · DOI: 10.1104/pp.106.092155
`At3g17630`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At5g41610`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At4g23700`	Operates as a K(+)/H(+) antiporter that controls K(+) acquisition and homeostasis.	Characterization of AtCHX17, a member of the cation/H+ exchangers, CHX family, from Arabidopsis thaliana suggests a role in K+ homeostasis.2004 · DOI: 10.1111/j.1365-313x.2004.02177.x Arabidopsis thaliana CHX17 gene complements the kha1 deletion phenotypes in Saccharomyces cerevisiae.2006 · DOI: 10.1002/yea.1424
`At1g64170`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032748 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006623 protein targeting to vacuole Biological Process

GO:0006813 potassium ion transport Biological Process

GO:0006885 regulation of pH Biological Process

GO:0030007 intracellular potassium ion homeostasis Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G64170

ath:AT3G17630

ath:AT3G53720

ath:AT4G23700

ath:AT5G41610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.736

Rank 1 · TkA08G203130 · TK1151

Endoplasmic reticulum0.121

Rank 2 · TkA08G203130 · TK1151

Lysosome / Vacuole0.085

Rank 3 · TkA08G203130 · TK1151

Cytoplasm0.064

Rank 4 · TkA08G203130 · TK1151

Golgi apparatus0.045

Rank 5 · TkA08G203130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00999Na_H_Exchanger37-422 aa

PF28153VraH262-282 aa

PF28153VraH394-422 aa

PF23256CHX17_2nd490-598 aa

PF06434Aconitase_2_N499-562 aa

PF00582Usp542-593 aa

PF23259CHX17_C607-752 aa

PF00582Usp607-709 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G203130	`PF00999`	Na_H_Exchanger	37	422	6.4e-61	207.0
TkA08G203130	`PF28153`	VraH	262	282	0.62	10.6
TkA08G203130	`PF28153`	VraH	394	422	0.62	10.6
TkA08G203130	`PF23256`	CHX17_2nd	490	598	4.8e-23	82.4
TkA08G203130	`PF06434`	Aconitase_2_N	499	562	0.24	11.8
TkA08G203130	`PF00582`	Usp	542	593	0.00013	23.3
TkA08G203130	`PF23259`	CHX17_C	607	752	2e-24	87.1
TkA08G203130	`PF00582`	Usp	607	709	0.00013	23.3
TkA08G203130	`PF28806`	PIM1	649	691	0.057	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M353`	Arabidopsis thaliana	sp\|Q9M353\|CHX20_ARATH Cation/H(+) antiporter 20	57.100%	Swiss-Prot	High
`Q9LUN4`	Arabidopsis thaliana	sp\|Q9LUN4\|CHX19_ARATH Cation/H(+) antiporter 19	48.100%	Swiss-Prot	Medium
`Q9FFR9`	Arabidopsis thaliana	sp\|Q9FFR9\|CHX18_ARATH Cation/H(+) antiporter 18	47.100%	Swiss-Prot	Medium
`Q9SUQ7`	Arabidopsis thaliana	sp\|Q9SUQ7\|CHX17_ARATH Cation/H(+) antiporter 17	45.400%	Swiss-Prot	Medium
`Q1HDT3`	Arabidopsis thaliana	sp\|Q1HDT3\|CHX16_ARATH Cation/H(+) antiporter 16	45.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card