LXL04_032748 | RubberDandelionOmics

Gene overview

LXL04_032748

Reference: OH-1004 Chr: Chr07 Coordinates: 28967805-28970875 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2439 bp · LXL04_032748|LXL04_032748|OH1004|cDNA

ATGAGTATTCTTAATCAAGAAAAAAAGAATACCAAAAAGGCAAACCACCTTCAAACCACAATTAACACATCCCTTCTATATATACGCACACATTTTGCAATCTTCCTTCCCACAAACGATCACACACATAGAAACATGGTATTTAACATAACCTCGGTTAAGACATCATCATATGGAGTGTGGCAAGGCAATAACCCTCTTCACTATGCATTTCCATTGTTGATACTTCAAACTACAATGGTTATCTTTATCAGTAGATT...

CDS

Download CDS FASTA

2439 bp · LXL04_032748|LXL04_032748|OH1004|CDS

ATGAGTATTCTTAATCAAGAAAAAAAGAATACCAAAAAGGCAAACCACCTTCAAACCACAATTAACACATCCCTTCTATATATACGCACACATTTTGCAATCTTCCTTCCCACAAACGATCACACACATAGAAACATGGTATTTAACATAACCTCGGTTAAGACATCATCATATGGAGTGTGGCAAGGCAATAACCCTCTTCACTATGCATTTCCATTGTTGATACTTCAAACTACAATGGTTATCTTTATCAGTAGATT...

Protein

Download Protein FASTA

812 aa · LXL04_032748|LXL04_032748|OH1004|PROTEIN

MSILNQEKKNTKKANHLQTTINTSLLYIRTHFAIFLPTNDHTHRNMVFNITSVKTSSYGVWQGNNPLHYAFPLLILQTTMVIFISRLLAFFLKPLRQPKVIAEILGGILLGPSGLGRNKEFMLWVFPSWSTPILETVASIGLLFFLFLVGLELDLISIRRSGKKALAIASAGILLPFVFGVGITVLLLKAVSGADKVGYIQCFLFMGVSLSITAFPVLARILAELKLLTTSVGETAMAAAAFNDIAAWVLLALAVALAGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032748`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032748

Location Chr07:28967805-28970875 (-)

Description Similar to CHX20: Cation/H(+) antiporter 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53720`	May act as a K⁺/H⁺ antiporter that maintains guard-cell K⁺ homeostasis and regulates pH.	Participation of endomembrane cation/H+ exchanger AtCHX20 in osmoregulation of guard cells.2007 · DOI: 10.1104/pp.106.092155
`At4g23700`	Operates as a K(+)/H(+) antiporter that controls K(+) acquisition and homeostasis.	Characterization of AtCHX17, a member of the cation/H+ exchangers, CHX family, from Arabidopsis thaliana suggests a role in K+ homeostasis.2004 · DOI: 10.1111/j.1365-313x.2004.02177.x Arabidopsis thaliana CHX17 gene complements the kha1 deletion phenotypes in Saccharomyces cerevisiae.2006 · DOI: 10.1002/yea.1424
`At5g41610`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At3g17630`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release
`At1g64170`	May operate as a cation/H(+) antiporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032748 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006623 protein targeting to vacuole Biological Process

GO:0006813 potassium ion transport Biological Process

GO:0006885 regulation of pH Biological Process

GO:0030007 intracellular potassium ion homeostasis Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:1902600 proton transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005770 late endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G64170

ath:AT3G17630

ath:AT3G53720

ath:AT4G23700

ath:AT5G41610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.709

Rank 1 · LXL04_032748 · OH-1004

Endoplasmic reticulum0.134

Rank 2 · LXL04_032748 · OH-1004

Lysosome / Vacuole0.095

Rank 3 · LXL04_032748 · OH-1004

Cytoplasm0.067

Rank 4 · LXL04_032748 · OH-1004

Golgi apparatus0.049

Rank 5 · LXL04_032748 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00999.27Na_H_Exchanger82-467 aa

PF23256.2CHX17_2nd535-643 aa

PF23259.2CHX17_C652-793 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032748	`PF00999.27`	Na_H_Exchanger	82	467	7.3e-61	206.8
LXL04_032748	`PF23256.2`	CHX17_2nd	535	643	4.8e-23	82.4
LXL04_032748	`PF23259.2`	CHX17_C	652	793	3.9e-23	82.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M353`	Arabidopsis thaliana	Cation/H(+) antiporter 20	56.851%	Swiss-Prot	strong database homology
`Q9SUQ7`	Arabidopsis thaliana	Cation/H(+) antiporter 17	45.761%	Swiss-Prot	moderate database homology
`Q9FFR9`	Arabidopsis thaliana	Cation/H(+) antiporter 18	47.044%	Swiss-Prot	moderate database homology
`Q9LUN4`	Arabidopsis thaliana	Cation/H(+) antiporter 19	48.000%	Swiss-Prot	moderate database homology
`Q1HDT3`	Arabidopsis thaliana	Cation/H(+) antiporter 16	45.223%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card