TkA08G202950 | RubberDandelionOmics

Gene overview

TkA08G202950

Reference: TK1151 Chr: Chr08 Coordinates: 53053574-53055829 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2256 bp · TkA08G202950|TK1151|cDNA

ATGGCTTTTTCCTCTTGTTTAAGTTGCGACCCCTGGACTCTTCCTAAAAACCTAAACCACCCCTCTCTATTTCCCACTCCCACAAAGCTCTCTAACTTCGTCTCCTTCGCATCAACAAAACCCTACGAGCAACTCACCACTTTACCTTCCGAAAAAGAACTCATTGACATCCTACGTCGTGAAAAAGATGAACATTCAGTCCTAAACGCCTTCAAATGGGCTTTAAAACAACCAAGTTTCCAACCCTCTTTATCCATCTA...

CDS

Download CDS FASTA

2256 bp · TkA08G202950|TK1151|CDS

ATGGCTTTTTCCTCTTGTTTAAGTTGCGACCCCTGGACTCTTCCTAAAAACCTAAACCACCCCTCTCTATTTCCCACTCCCACAAAGCTCTCTAACTTCGTCTCCTTCGCATCAACAAAACCCTACGAGCAACTCACCACTTTACCTTCCGAAAAAGAACTCATTGACATCCTACGTCGTGAAAAAGATGAACATTCAGTCCTAAACGCCTTCAAATGGGCTTTAAAACAACCAAGTTTCCAACCCTCTTTATCCATCTA...

Protein

Download Protein FASTA

751 aa · TkA08G202950|TK1151|PROTEIN

MAFSSCLSCDPWTLPKNLNHPSLFPTPTKLSNFVSFASTKPYEQLTTLPSEKELIDILRREKDEHSVLNAFKWALKQPSFQPSLSIYEEMLKKLGQVGSIDSIRGVLDDMKKSSCKVAEDTFFILIENFAKFNLYDEAICVLFIMDEEFGVKPGTHTFNFLLNVLVDGNKLKLVEDVHSLMSSSRIKKDVSTYNILIKALCKAHQMRPAVLMMEDMPTHGLTPDEKTYTTLMHGFIEEGNLNGALRIKEQMTSAKCELTN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G202950`
TK1151 ID	TkA08G202950
OH-1004 ID	LXL04_032744
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 25.433 / OH-1004 25.433 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G202950

Location Chr08:53053574-53055829 (-)

Description Similar to MEE40: Pentatricopeptide repeat-containing protein At3g53700, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g53700`	May be involved in female gametophyte development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032744 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010239 chloroplast mRNA processing Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G74580

ath:AT3G53700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.735

Rank 1 · TkA08G202950 · TK1151

Plastid0.185

Rank 2 · TkA08G202950 · TK1151

Nucleus0.058

Rank 3 · TkA08G202950 · TK1151

Cytoplasm0.032

Rank 4 · TkA08G202950 · TK1151

Cell membrane0.012

Rank 5 · TkA08G202950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06239ECSIT_N9-20 aa

PF29070MSC6_N46-206 aa

PF23279TPR_2576-112 aa

PF13812PPR_379-128 aa

PF13041PPR_283-131 aa

PF22330Rib_mS39_PPR84-136 aa

PF01535PPR90-115 aa

PF23276TPR_2490-166 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G202950	`PF06239`	ECSIT_N	9	20	0.0047	16.9
TkA08G202950	`PF29070`	MSC6_N	46	206	2.2e-41	142.9
TkA08G202950	`PF23279`	TPR_25	76	112	0.00071	20.4
TkA08G202950	`PF13812`	PPR_3	79	128	4.5e-80	264.4
TkA08G202950	`PF13041`	PPR_2	83	131	5.3e-195	632.3
TkA08G202950	`PF22330`	Rib_mS39_PPR	84	136	0.0014	19.2
TkA08G202950	`PF01535`	PPR	90	115	7.2e-102	327.5
TkA08G202950	`PF23276`	TPR_24	90	166	5.3e-48	163.0
TkA08G202950	`PF17177`	PPR_long	98	203	4.8e-41	141.2
TkA08G202950	`PF10037`	MRP-S27	116	165	3e-22	79.9
TkA08G202950	`PF24760`	TPR_IF140_C	117	142	4.2e-07	31.1
TkA08G202950	`PF12854`	PPR_1	121	139	1.1e-150	489.7
TkA08G202950	`PF13041`	PPR_2	124	166	5.3e-195	632.3
TkA08G202950	`PF01535`	PPR	124	147	7.2e-102	327.5
TkA08G202950	`PF29978`	ATP18_TPR	126	167	1.8e-11	44.8
TkA08G202950	`PF12854`	PPR_1	150	164	1.1e-150	489.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFF1`	Arabidopsis thaliana	sp\|Q9LFF1\|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic	44.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card