TkA08G199310 | RubberDandelionOmics

Gene overview

TkA08G199310

Reference: TK1151 Chr: Chr08 Coordinates: 52050778-52057870 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2146 bp · TkA08G199310|TK1151|cDNA

TTTCATTCTACTCCATCAATCCTATAGAATTTGGAACAAAAAAAATGCTATTAAAAACCGTGAGAAACAGCCAACACAAAGCCTTCATTCTGCAAAAGGTTTTTTCTGTTTGAATCGAAGGCGGGCTTCAACTTTCGAGTGTATCTAGTCGAAGTCGAAAATGGAAGTCCCCAAGGATCAGATGTCTACTCTCCTCGATTGCGGTCTTTATAACTCTGCTCAAATGCTCGGCTGTTTCCTGTGTTTCTTCATCTTCTGTG...

CDS

Download CDS FASTA

582 bp · TkA08G199310|TK1151|CDS

ATGAATCTGTTATTGGGAAAGCTTTATCGATATTCTAAACACACTCGTCCTGCCATTGCTTGTTACAAAGAATGCCTAAGACATTGCCCGTATATCATTGAGGCTATTACATCATTGGCTGAGTTAGGTGTTCAAGCAAAGATATTTTTTTCATTGCTTCCACAGACACCTAACAGAAGTGGCAGGCCTCCTTTTGATCATTATTATAATGTTTTTGTTATGCAGCGTTATGTTGAGGCTCAATGTTGCATTGCATCAAA...

Protein

Download Protein FASTA

193 aa · TkA08G199310|TK1151|PROTEIN

MNLLLGKLYRYSKHTRPAIACYKECLRHCPYIIEAITSLAELGVQAKIFFSLLPQTPNRSGRPPFDHYYNVFVMQRYVEAQCCIASNDYKGGLEISQNFSAVSHNVHILLEMAKVEAIIGKNEEAIMNFEKVRSIDPYVVTYMDEYAMLLKLKSDPMKLNKLVHDLLSIDPARPEVFVALSVLWEGKMTGCLN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G199310`
TK1151 ID	TkA08G199310
OH-1004 ID	LXL04_028965
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.400
Protein coverage (%)	TK1151 96.891 / OH-1004 32.470 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G199310

Location Chr08:52050778-52057870 (+)

Description Similar to APC7: Anaphase-promoting complex subunit 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39090`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028965 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0007091 metaphase/anaphase transition of mitotic cell cycle Biological Process

GO:0007096 regulation of exit from mitosis Biological Process

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030071 regulation of mitotic metaphase/anaphase transition Biological Process

GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process

GO:0045842 positive regulation of mitotic metaphase/anaphase transition Biological Process

GO:0051301 cell division Biological Process

GO:0051445 regulation of meiotic cell cycle Biological Process

KEGG gene cross-reference

ath:AT2G39090

ddi:DDB_G0292470

hsa:51434

hsa:8697

mmu:56317

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.516

Rank 1 · TkA08G199310 · TK1151

Nucleus0.373

Rank 2 · TkA08G199310 · TK1151

Golgi apparatus0.070

Rank 3 · TkA08G199310 · TK1151

Lysosome / Vacuole0.070

Rank 4 · TkA08G199310 · TK1151

Endoplasmic reticulum0.065

Rank 5 · TkA08G199310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13428TPR_143-42 aa

PF13181TPR_83-27 aa

PF23914TPR_CcmH_CycH3-41 aa

PF07719TPR_24-30 aa

PF13424TPR_124-27 aa

PF12895ANAPC34-25 aa

PF00515TPR_15-30 aa

PF13414TPR_1118-27 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G199310	`PF13428`	TPR_14	3	42	1e-05	26.4
TkA08G199310	`PF13181`	TPR_8	3	27	0.00011	22.8
TkA08G199310	`PF23914`	TPR_CcmH_CycH	3	41	0.065	13.8
TkA08G199310	`PF07719`	TPR_2	4	30	0.00019	22.0
TkA08G199310	`PF13424`	TPR_12	4	27	0.0007	20.5
TkA08G199310	`PF12895`	ANAPC3	4	25	0.054	14.5
TkA08G199310	`PF00515`	TPR_1	5	30	6.1e-05	23.4
TkA08G199310	`PF13414`	TPR_11	18	27	0.16	12.4
TkA08G199310	`PF12895`	ANAPC3	76	131	0.054	14.5
TkA08G199310	`PF07719`	TPR_2	78	91	0.00019	22.0
TkA08G199310	`PF13414`	TPR_11	85	99	0.16	12.4
TkA08G199310	`PF13428`	TPR_14	107	147	1e-05	26.4
TkA08G199310	`PF13424`	TPR_12	108	135	0.0007	20.5
TkA08G199310	`PF13181`	TPR_8	109	137	0.00011	22.8
TkA08G199310	`PF07719`	TPR_2	109	137	0.00019	22.0
TkA08G199310	`PF23914`	TPR_CcmH_CycH	113	161	0.065	13.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY89`	Arabidopsis thaliana	sp\|Q8VY89\|APC7_ARATH Anaphase-promoting complex subunit 7	62.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card