LXL04_028965 | RubberDandelionOmics

Gene overview

LXL04_028965

Reference: OH-1004 Chr: Chr06 Coordinates: 76097168-76102479 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1740 bp · LXL04_028965|LXL04_028965|OH1004|cDNA

ATGGAAGTCCCCAAGGATCAGATGTCTACTCTCCTCGATTGCGGTCTTTATAACTCTGCTCAAATGCTCGTAAATCTCCTTTCCTCTATCATTGCCACCATCCAGTCGGAGTCGGATATAGGCTGTTTCCTTGTTTCTTCATCTTCTGTGAATAATGACACCAGCCCGCACCTCAAGGCTGAAAATCTGGCTCTCCATGGTGATGCCTTGTTTCGAGATAAAGAGTACAGAAGAGCTATACATGTGTACAAGCAAGCATT...

CDS

Download CDS FASTA

1740 bp · LXL04_028965|LXL04_028965|OH1004|CDS

ATGGAAGTCCCCAAGGATCAGATGTCTACTCTCCTCGATTGCGGTCTTTATAACTCTGCTCAAATGCTCGTAAATCTCCTTTCCTCTATCATTGCCACCATCCAGTCGGAGTCGGATATAGGCTGTTTCCTTGTTTCTTCATCTTCTGTGAATAATGACACCAGCCCGCACCTCAAGGCTGAAAATCTGGCTCTCCATGGTGATGCCTTGTTTCGAGATAAAGAGTACAGAAGAGCTATACATGTGTACAAGCAAGCATT...

Protein

Download Protein FASTA

579 aa · LXL04_028965|LXL04_028965|OH1004|PROTEIN

MEVPKDQMSTLLDCGLYNSAQMLVNLLSSIIATIQSESDIGCFLVSSSSVNNDTSPHLKAENLALHGDALFRDKEYRRAIHVYKQALQYHKIIPKVNATTRSSLSTSNRSSSPNSFNLSAINENEVKFKIASCHCAINENRAALAEMEAIPSKARNLQMNLLLGKLYRYSKHTRPAIACYKECLRHCPYIIEAITSLAELGVQAKDIFSLLPQTPNRSGRPPFDQFESGRWLQRYVEAQCCIASNDYKGGLEIFSELLQR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_028965`
TK1151 ID	TkA08G199310
OH-1004 ID	LXL04_028965
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.400
Protein coverage (%)	TK1151 96.891 / OH-1004 32.470 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_028965

Location Chr06:76097168-76102479 (+)

Description Similar to APC7: Anaphase-promoting complex subunit 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g39090`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_028965 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0007080 mitotic metaphase chromosome alignment Biological Process

GO:0007091 metaphase/anaphase transition of mitotic cell cycle Biological Process

GO:0007096 regulation of exit from mitosis Biological Process

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0030071 regulation of mitotic metaphase/anaphase transition Biological Process

GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process

GO:0045842 positive regulation of mitotic metaphase/anaphase transition Biological Process

GO:0051301 cell division Biological Process

GO:0051445 regulation of meiotic cell cycle Biological Process

KEGG gene cross-reference

ath:AT2G39090

ddi:DDB_G0292470

hsa:51434

hsa:8697

mmu:56317

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.468

Rank 1 · LXL04_028965 · OH-1004

Cytoplasm0.436

Rank 2 · LXL04_028965 · OH-1004

Lysosome / Vacuole0.115

Rank 3 · LXL04_028965 · OH-1004

Golgi apparatus0.100

Rank 4 · LXL04_028965 · OH-1004

Cell membrane0.059

Rank 5 · LXL04_028965 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY89`	Arabidopsis thaliana	Anaphase-promoting complex subunit 7	68.394%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card