TkA08G194770 | RubberDandelionOmics

Gene overview

TkA08G194770

Reference: TK1151 Chr: Chr08 Coordinates: 50886067-50886963 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

813 bp · TkA08G194770|TK1151|cDNA

ATGGTAGTCGCCGTAAAGAGAATCAAAGAAATGGATTCTTTGAGAAAAAAGGAATTTGTACAACAAATGCAATTGCTCGGAAAGTTGAAGCATCAAAACCTCGTAGAGATCGTTTCCTTCTATTATTCCAAAGACGAAAAGCTAATCATTCGTGAATTCATCCAAGATGGAAGCCTATTCGAGTTATTACATGAGAATCGAGGGTTTCGGAGAGTATCACTCGATTGGACAACAAGGGTACGAATCATGGAAGATGTTGC...

CDS

Download CDS FASTA

813 bp · TkA08G194770|TK1151|CDS

ATGGTAGTCGCCGTAAAGAGAATCAAAGAAATGGATTCTTTGAGAAAAAAGGAATTTGTACAACAAATGCAATTGCTCGGAAAGTTGAAGCATCAAAACCTCGTAGAGATCGTTTCCTTCTATTATTCCAAAGACGAAAAGCTAATCATTCGTGAATTCATCCAAGATGGAAGCCTATTCGAGTTATTACATGAGAATCGAGGGTTTCGGAGAGTATCACTCGATTGGACAACAAGGGTACGAATCATGGAAGATGTTGC...

Protein

Download Protein FASTA

270 aa · TkA08G194770|TK1151|PROTEIN

MVVAVKRIKEMDSLRKKEFVQQMQLLGKLKHQNLVEIVSFYYSKDEKLIIREFIQDGSLFELLHENRGFRRVSLDWTTRVRIMEDVAKGLIFLNQSLPSQKVAHGNLKSSNVLITFTNETETETVHAKLTDYGYFPLLPSRKSSKKLAIGKCPEFIEGKKLTQKADVYSFGVLLLEIITGKAPGDNNNSRNNDHEDLSAWVRGALNSDWSMDIFDLEILVEKEEHEDMLKLAELALDCTHALPERRPKMTQILIRLQEII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G194770`
TK1151 ID	TkA08G194770
OH-1004 ID	LXL04_032659
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 44.628 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G194770

Location Chr08:50886067-50886963 (+)

Description Similar to PXC1: Leucine-rich repeat receptor-like protein kinase PXC1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68400`	Probable leucine-rich repeat receptor-like protein kinase At1g68400.	No verified direct reference in this release
`At2g36570`	Leucine-rich repeat receptor-like protein kinase involved in secondary cell wall formation in xylem fibers.	The Arabidopsis LRR-RLK, PXC1, is a regulator of secondary wall formation correlated with the TDIF-PXY/TDR-WOX4 signaling pathway.2013 · DOI: 10.1186/1471-2229-13-94
`At5g35390`	Receptor-like kinase involved in the control of pollen germination and pollen tube polar growth.	AtPRK2 promotes ROP1 activation via RopGEFs in the control of polarized pollen tube growth.2013 · DOI: 10.1093/mp/sss103
`At1g48480`	Probable inactive receptor kinase At1g48480.	No verified direct reference in this release
`At2g26730`	Probable inactive receptor kinase At2g26730.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032659 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009834 plant-type secondary cell wall biogenesis Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016324 apical plasma membrane Cellular Component

GO:0045177 apical part of cell Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G48480

ath:AT1G68400

ath:AT2G36570

ath:AT4G31250

ath:AT5G35390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.560

Rank 1 · TkA08G194770 · TK1151

Cytoplasm0.353

Rank 2 · TkA08G194770 · TK1151

Nucleus0.262

Rank 3 · TkA08G194770 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA08G194770 · TK1151

Golgi apparatus0.028

Rank 5 · TkA08G194770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr2-255 aa

PF00069Pkinase2-253 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G194770	`PF07714`	PK_Tyr_Ser-Thr	2	255	1.2e-30	107.4
TkA08G194770	`PF00069`	Pkinase	2	253	3.5e-28	99.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9C5`	Arabidopsis thaliana	sp\|Q9M9C5\|Y1680_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g68400	41.100%	Swiss-Prot	Medium
`Q9SJQ1`	Arabidopsis thaliana	sp\|Q9SJQ1\|PXC1_ARATH Leucine-rich repeat receptor-like protein kinase PXC1	40.400%	Swiss-Prot	Medium
`C0LGU0`	Arabidopsis thaliana	sp\|C0LGU0\|PRK1_ARATH Pollen receptor-like kinase 1	38.400%	Swiss-Prot	Medium
`Q9LP77`	Arabidopsis thaliana	sp\|Q9LP77\|Y1848_ARATH Probable inactive receptor kinase At1g48480	39.600%	Swiss-Prot	Medium
`O48788`	Arabidopsis thaliana	sp\|O48788\|Y2267_ARATH Probable inactive receptor kinase At2g26730	39.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card