TkA08G189380 | RubberDandelionOmics

Gene overview

TkA08G189380

Reference: TK1151 Chr: Chr08 Coordinates: 49472952-49474031 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1080 bp · TkA08G189380|TK1151|cDNA

ATGGGGATCGAAACGACGAAGGAATCACCATGGTTTACTACCATCTGGAAATCTTCACGTAAACCCACAATCCCGGAACCCAAAAAACCCGTTATCGGAATCATGTCATTCGAAGTCTCCAGATTAATGACAAAAGTCGCTAATTTATGGCAAATCCTAACCACTAAACAAATGACCCGGCTACAAGACCAACTCATTACGTCACTCGGCACTCGGAAACTCGTTTCAGATGATTACAATTACCTCATGGAGCTTGCACT...

CDS

Download CDS FASTA

1080 bp · TkA08G189380|TK1151|CDS

ATGGGGATCGAAACGACGAAGGAATCACCATGGTTTACTACCATCTGGAAATCTTCACGTAAACCCACAATCCCGGAACCCAAAAAACCCGTTATCGGAATCATGTCATTCGAAGTCTCCAGATTAATGACAAAAGTCGCTAATTTATGGCAAATCCTAACCACTAAACAAATGACCCGGCTACAAGACCAACTCATTACGTCACTCGGCACTCGGAAACTCGTTTCAGATGATTACAATTACCTCATGGAGCTTGCACT...

Protein

Download Protein FASTA

359 aa · TkA08G189380|TK1151|PROTEIN

MGIETTKESPWFTTIWKSSRKPTIPEPKKPVIGIMSFEVSRLMTKVANLWQILTTKQMTRLQDQLITSLGTRKLVSDDYNYLMELALLEILDNIKCVGQTVARLGKKSTDPIYHNLDHTFDNPMEIDVNWCGWEYRLKKMEKRIKKMKRFAAVTSQLYEELEVLYELENGLKTMQENNNTDQMKLHEYEEKVTWQREEVDGLRDMSVWVRPYDYIVRLLVRSLFTIVNRVKGVFGNTQRSSDYISRGGSDGRCFARSNSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G189380`
TK1151 ID	TkA08G189380
OH-1004 ID	LXL04_032579
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 94.429 / OH-1004 69.897 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G189380`
Location	Chr08:49472952-49474031 (+)
Description	Similar to PSI1: Protein PSK SIMULATOR 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032579` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006109 regulation of carbohydrate metabolic process Biological Process GO:0009744 response to sucrose Biological Process GO:0043434 response to peptide hormone Biological Process GO:0045927 positive regulation of growth Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0003746 translation elongation factor activity Molecular Function
KEGG gene cross-reference	ath:AT1G30755 ath:AT1G34320 ath:AT5G08660 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.463

Rank 1 · TkA08G189380 · TK1151

Nucleus0.296

Rank 2 · TkA08G189380 · TK1151

Cell membrane0.218

Rank 3 · TkA08G189380 · TK1151

Mitochondrion0.095

Rank 4 · TkA08G189380 · TK1151

Endoplasmic reticulum0.080

Rank 5 · TkA08G189380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11961DUF347534-90 aa

PF13094CENP-Q148-198 aa

PF05003DUF668156-192 aa

PF11961DUF3475256-265 aa

PF05003DUF668312-339 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G189380	`PF11961`	DUF3475	34	90	2.2e-17	63.6
TkA08G189380	`PF13094`	CENP-Q	148	198	1.4	9.7
TkA08G189380	`PF05003`	DUF668	156	192	1.8e-06	29.0
TkA08G189380	`PF11961`	DUF3475	256	265	2.2e-17	63.6
TkA08G189380	`PF05003`	DUF668	312	339	1.8e-06	29.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card