LXL04_032579 | RubberDandelionOmics

Gene overview

LXL04_032579

Reference: OH-1004 Chr: Chr07 Coordinates: 25784056-25785513 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1458 bp · LXL04_032579|LXL04_032579|OH1004|cDNA

ATGGGGATCGAAACGACGAAGGAATCACCATGGTTTACTACCATCTGGAAATCTTCACGTAAACCCACAATCCCGGAACCCAAAAAACCCGTTATCGGAATCATGTCATTCGAAGTCTCCAGATTAATGACAAAAGTCGCTAATTTATGGCAAATCCTAACCACTAAACAAATGACCCGGCTACAAGACCAACTCATTACGTCACTCGGCACTCGGAAACTCGTTTCAGATGATTACAATTACCTCATGGAGCTTGCACT...

CDS

Download CDS FASTA

1458 bp · LXL04_032579|LXL04_032579|OH1004|CDS

ATGGGGATCGAAACGACGAAGGAATCACCATGGTTTACTACCATCTGGAAATCTTCACGTAAACCCACAATCCCGGAACCCAAAAAACCCGTTATCGGAATCATGTCATTCGAAGTCTCCAGATTAATGACAAAAGTCGCTAATTTATGGCAAATCCTAACCACTAAACAAATGACCCGGCTACAAGACCAACTCATTACGTCACTCGGCACTCGGAAACTCGTTTCAGATGATTACAATTACCTCATGGAGCTTGCACT...

Protein

Download Protein FASTA

485 aa · LXL04_032579|LXL04_032579|OH1004|PROTEIN

MGIETTKESPWFTTIWKSSRKPTIPEPKKPVIGIMSFEVSRLMTKVANLWQILTTKQMTRLQDQLITSLGTRKLVSDDYNYLMELALLEILDNIKCVGQTVARLGKKSTDPIYHNLDHTFDNPMEIDVNWCGWEYRLKKMEKRIKKMKRFAAVTSQLYEELEVLYELENGLKTMQENNNTDQMKLDEYEEKVTWQREEVDGLRDMSVWVRPYDYIVRLLVRSLFTIVNRVKGVFGISQRSSDYISRGGSDGRCFARSNSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032579`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032579

Location Chr07:25784056-25785513 (+)

Description Similar to PSI1: Protein PSK SIMULATOR 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34320`	Promotes seedling growth probably via the regulation of phytosulfokine (PSK) signaling.	The PSI family of nuclear proteins is required for growth in arabidopsis.2014 · DOI: 10.1007/s11103-014-0229-2
`At5g08660`	Promotes plant growth, especially at the vegetative stage, probably via the regulation of phytosulfokine (PSK) signaling; PSK are peptide phytohormones acting as growth factors.	The PSI family of nuclear proteins is required for growth in arabidopsis.2014 · DOI: 10.1007/s11103-014-0229-2
`At1g30755`	Promotes seedling growth probably via the regulation of phytosulfokine (PSK) signaling.	The PSI family of nuclear proteins is required for growth in arabidopsis.2014 · DOI: 10.1007/s11103-014-0229-2

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032579 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006109 regulation of carbohydrate metabolic process Biological Process

GO:0009744 response to sucrose Biological Process

GO:0043434 response to peptide hormone Biological Process

GO:0045927 positive regulation of growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003746 translation elongation factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G30755

ath:AT1G34320

ath:AT5G08660

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.482

Rank 1 · LXL04_032579 · OH-1004

Nucleus0.288

Rank 2 · LXL04_032579 · OH-1004

Cell membrane0.243

Rank 3 · LXL04_032579 · OH-1004

Mitochondrion0.072

Rank 4 · LXL04_032579 · OH-1004

Golgi apparatus0.071

Rank 5 · LXL04_032579 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11961.14DUF347534-90 aa

PF05003.18DUF668312-399 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032579	`PF11961.14`	DUF3475	34	90	1.3e-17	64.2
LXL04_032579	`PF05003.18`	DUF668	312	399	5e-28	98.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XID5`	Arabidopsis thaliana	Protein PSK SIMULATOR 1	26.512%	Swiss-Prot	weak database homology
`P0DO24`	Arabidopsis thaliana	Protein PSK SIMULATOR 3	25.000%	Swiss-Prot	weak database homology
`Q9SA91`	Arabidopsis thaliana	Protein PSK SIMULATOR 2	34.228%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card