TkA08G189110 | RubberDandelionOmics

Gene overview

TkA08G189110

Reference: TK1151 Chr: Chr08 Coordinates: 49404614-49405162 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · TkA08G189110|TK1151|cDNA

ATGTGGAAAAATGATACCACTTCTCCTTCTGCAAGTTCTTCTGGAAAACACCCGAAATATTGGGGAGTAAGGCAAAGACGAAGTAGTCAGAAATGGGTTTCAGAAATCCGGGAGCCCAAGTCACCAAATCGTATTTGGCTTGGTACATTTCCCACCCCTGAAATGGCAGCGGTGGCTTACGATGTAGCAGCACTGGCGGTTAAAGGTAAAGATGCGGAGCTTAATTTCCCAAATTCAGCTTCTTCTTTGCCTGTGCCAGC...

CDS

Download CDS FASTA

519 bp · TkA08G189110|TK1151|CDS

ATGTGGAAAAATGATACCACTTCTCCTTCTGCAAGTTCTTCTGGAAAACACCCGAAATATTGGGGAGTAAGGCAAAGACGAAGTAGTCAGAAATGGGTTTCAGAAATCCGGGAGCCCAAGTCACCAAATCGTATTTGGCTTGGTACATTTCCCACCCCTGAAATGGCAGCGGTGGCTTACGATGTAGCAGCACTGGCGGTTAAAGGTAAAGATGCGGAGCTTAATTTCCCAAATTCAGCTTCTTCTTTGCCTGTGCCAGC...

Protein

Download Protein FASTA

172 aa · TkA08G189110|TK1151|PROTEIN

MWKNDTTSPSASSSGKHPKYWGVRQRRSSQKWVSEIREPKSPNRIWLGTFPTPEMAAVAYDVAALAVKGKDAELNFPNSASSLPVPASSSPRDIQEAAATAAAAMDAFLGAHGHVDQPLIGGGGYVDEDMIFNMPNVLANMAEGMLLSPPRVDFLNDETDGNYSLDHYDLWN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G189110`
TK1151 ID	TkA08G189110
OH-1004 ID	LXL04_032573
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.900
Protein coverage (%)	TK1151 100.000 / OH-1004 96.809 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G189110

Location Chr08:49404614-49405162 (+)

Description Similar to ERF024: Ethylene-responsive transcription factor ERF024

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36450`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At1g63040`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At4g25490`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'.	Genetic and molecular analyses of natural variation indicate CBF2 as a candidate gene for underlying a freezing tolerance quantitative trait locus in Arabidopsis.2005 · DOI: 10.1104/pp.105.068510

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WZI4`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'.	No verified direct reference in this release
`Os01g0968800`	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032573 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G36450

ath:AT4G25490

ath:AT5G51990

dosa:Os01g0968800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.955

Rank 1 · TkA08G189110 · TK1151

Cytoplasm0.101

Rank 2 · TkA08G189110 · TK1151

Cell membrane0.029

Rank 3 · TkA08G189110 · TK1151

Endoplasmic reticulum0.028

Rank 4 · TkA08G189110 · TK1151

Plastid0.020

Rank 5 · TkA08G189110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP218-69 aa

PF18537CODH_A_N64-95 aa

PF00847AP297-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G189110	`PF00847`	AP2	18	69	8.8e-12	45.9
TkA08G189110	`PF18537`	CODH_A_N	64	95	0.045	14.5
TkA08G189110	`PF00847`	AP2	97	103	8.8e-12	45.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJR0`	Arabidopsis thaliana	sp\|Q9SJR0\|ERF24_ARATH Ethylene-responsive transcription factor ERF024	56.900%	Swiss-Prot	High
`Q9CAN9`	Arabidopsis thaliana	sp\|Q9CAN9\|ERF26_ARATH Ethylene-responsive transcription factor ERF026	54.200%	Swiss-Prot	High
`P93835`	Arabidopsis thaliana	sp\|P93835\|DRE1B_ARATH Dehydration-responsive element-binding protein 1B	48.500%	Swiss-Prot	Medium
`A2WZI4`	Oryza sativa subsp. indica	sp\|A2WZI4\|DRE1F_ORYSI Dehydration-responsive element-binding protein 1F	45.500%	Swiss-Prot	Medium
`Q8S9Z5`	Oryza sativa subsp. japonica	sp\|Q8S9Z5\|DRE1F_ORYSJ Dehydration-responsive element-binding protein 1F	45.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card