TkA08G188100 | RubberDandelionOmics

Gene overview

TkA08G188100

Reference: TK1151 Chr: Chr08 Coordinates: 49129750-49131797 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1368 bp · TkA08G188100|TK1151|cDNA

ATGGAGGAAACGTATGGGCTGAGGGATCTGTCCCATTACATGAACGAAAGACCCATCTTCTCTTCCATGCCTCACCCACAGTCTCAGCCTCCTCGTGACCTGCACTACGCCATGTTAATGTTGGGTGGCGGTGGTGGTGGTGGTGGAATGTCGTTTGGATCTGATTCGACGACGATGGGTATGGGGTCAACTACTTCGGGTCTTAACGCCGACAGCGGTGGCGGTGGTAATGGTTTGGACATGGAGATTGGTGTTTATGG...

CDS

Download CDS FASTA

1368 bp · TkA08G188100|TK1151|CDS

ATGGAGGAAACGTATGGGCTGAGGGATCTGTCCCATTACATGAACGAAAGACCCATCTTCTCTTCCATGCCTCACCCACAGTCTCAGCCTCCTCGTGACCTGCACTACGCCATGTTAATGTTGGGTGGCGGTGGTGGTGGTGGTGGAATGTCGTTTGGATCTGATTCGACGACGATGGGTATGGGGTCAACTACTTCGGGTCTTAACGCCGACAGCGGTGGCGGTGGTAATGGTTTGGACATGGAGATTGGTGTTTATGG...

Protein

Download Protein FASTA

455 aa · TkA08G188100|TK1151|PROTEIN

MEETYGLRDLSHYMNERPIFSSMPHPQSQPPRDLHYAMLMLGGGGGGGGMSFGSDSTTMGMGSTTSGLNADSGGGGNGLDMEIGVYGGRWTREETLTLLEIRSGLDSMFKEANHKGPVWDEVSRIMSAEHGYRRTGKKCSEKFENLYKYYKKIKLGKAGRQDKKHYRFFSQLEAIYGETSPNNPSAFDPYSNHYTPLPPFKEDSDGVERPMSNKKNMGKKHWKTMITDFIETKTQTLMEKQDAWMEKMMKTIDEKEKERI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G188100`
TK1151 ID	TkA08G188100
OH-1004 ID	LXL04_032559
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G188100

Location Chr08:49129750-49131797 (+)

Description Similar to PTL: Trihelix transcription factor PTL

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03680`	Transcription factor that prevents growth.	No verified direct reference in this release
`At1g33240`	Transcription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter.	The trihelix transcription factor GTL1 regulates ploidy-dependent cell growth in the Arabidopsis trichome.2009 · DOI: 10.1105/tpc.109.068387 The Arabidopsis GTL1 transcription factor regulates water use efficiency and drought tolerance by modulating stomatal density via transrepression of SDD1.2010 · DOI: 10.1105/tpc.110.078691 GTL1 and DF1 regulate root hair growth through transcriptional repression of ROOT HAIR DEFECTIVE 6-LIKE 4 in Arabidopsis.2018 · DOI: 10.1242/dev.159707
`At1g76890`	Probable transcription factor that binds specific DNA sequence.	No verified direct reference in this release
`At1g76880`	Transcription repressor that negatively regulates root hair growth by directly binding RSL4 promoter and repressing RSL4 expression.	No verified direct reference in this release
`At5g28300`	Probable transcription factor that binds specific DNA sequence.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032559 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0046621 negative regulation of organ growth Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0048358 mucilage pectin biosynthetic process Biological Process

GO:0048441 petal development Biological Process

GO:0048442 sepal development Biological Process

GO:0048498 establishment of petal orientation Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0090428 perianth development Biological Process

KEGG gene cross-reference

ath:AT1G76880

ath:AT1G76890

ath:AT5G03680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.981

Rank 1 · TkA08G188100 · TK1151

Cytoplasm0.060

Rank 2 · TkA08G188100 · TK1151

Cell membrane0.022

Rank 3 · TkA08G188100 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkA08G188100 · TK1151

Plastid0.011

Rank 5 · TkA08G188100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding88-145 aa

PF13837Myb_DNA-bind_489-175 aa

PF10545MADF_DNA_bdg109-173 aa

PF13837Myb_DNA-bind_4214-266 aa

PF00249Myb_DNA-binding217-225 aa

PF10545MADF_DNA_bdg247-268 aa

PF00249Myb_DNA-binding326-381 aa

PF13837Myb_DNA-bind_4327-398 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G188100	`PF00249`	Myb_DNA-binding	88	145	1.3	9.9
TkA08G188100	`PF13837`	Myb_DNA-bind_4	89	175	1.5e-32	112.5
TkA08G188100	`PF10545`	MADF_DNA_bdg	109	173	1.6	9.9
TkA08G188100	`PF13837`	Myb_DNA-bind_4	214	266	1.5e-32	112.5
TkA08G188100	`PF00249`	Myb_DNA-binding	217	225	1.3	9.9
TkA08G188100	`PF10545`	MADF_DNA_bdg	247	268	1.6	9.9
TkA08G188100	`PF00249`	Myb_DNA-binding	326	381	1.3	9.9
TkA08G188100	`PF13837`	Myb_DNA-bind_4	327	398	1.5e-32	112.5
TkA08G188100	`PF10545`	MADF_DNA_bdg	355	408	1.6	9.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZS0`	Arabidopsis thaliana	sp\|Q9LZS0\|PTL_ARATH Trihelix transcription factor PTL	43.000%	Swiss-Prot	Medium
`Q9C882`	Arabidopsis thaliana	sp\|Q9C882\|GTL1_ARATH Trihelix transcription factor GTL1	58.400%	Swiss-Prot	Low
`Q39117`	Arabidopsis thaliana	sp\|Q39117\|TGT2_ARATH Trihelix transcription factor GT-2	53.300%	Swiss-Prot	Low
`Q9C6K3`	Arabidopsis thaliana	sp\|Q9C6K3\|DF1_ARATH Trihelix transcription factor DF1	41.800%	Swiss-Prot	Low
`Q8H181`	Arabidopsis thaliana	sp\|Q8H181\|GTL2_ARATH Trihelix transcription factor GTL2	34.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card