LXL04_032559 | RubberDandelionOmics

Gene overview

LXL04_032559

Reference: OH-1004 Chr: Chr07 Coordinates: 25483471-25485513 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1425 bp · LXL04_032559|LXL04_032559|OH1004|cDNA

ATGGAGGAAACGTATGGGCTGAGGGATCTGTCCCATTACATGAACGAAAGACCCATCTTCTCTTCCATGCCTCACCCACAGTCTCAGCCTCCTCGTGACCTGCACTACGCCATGTTAATGTtgggtggcggtggtggtggtggtggaatGTCGTTTGGATCTGATTCGACGACGATGGGTATGGGGTCAACTACTTCGGGTCTTAACGCCGACAGCGGTGGCGGTGGTAATGGTTTGGACATGGAGATTGGTGTTTATGG...

CDS

Download CDS FASTA

1425 bp · LXL04_032559|LXL04_032559|OH1004|CDS

ATGGAGGAAACGTATGGGCTGAGGGATCTGTCCCATTACATGAACGAAAGACCCATCTTCTCTTCCATGCCTCACCCACAGTCTCAGCCTCCTCGTGACCTGCACTACGCCATGTTAATGTTGGGTGGCGGTGGTGGTGGTGGTGGAATGTCGTTTGGATCTGATTCGACGACGATGGGTATGGGGTCAACTACTTCGGGTCTTAACGCCGACAGCGGTGGCGGTGGTAATGGTTTGGACATGGAGATTGGTGTTTATGG...

Protein

Download Protein FASTA

474 aa · LXL04_032559|LXL04_032559|OH1004|PROTEIN

MEETYGLRDLSHYMNERPIFSSMPHPQSQPPRDLHYAMLMLGGGGGGGGMSFGSDSTTMGMGSTTSGLNADSGGGGNGLDMEIGVYGGRWTREETLTLLEIRSGLDSMFKEANHKGPVWDEVSRIMSAEHGYRRTGKKCSEKFENLYKYYKKIKLGKAGRQDKKHYRFFSQLEAIYGETSPSINPDDTNQPSVSNNPQLPNNPSAFDPYSNHYTPLPPFKEDSDGVERPMSNKKNMGKKHWKTMITDFIETKTQTLMEKQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032559`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032559

Location Chr07:25483471-25485513 (+)

Description Similar to PTL: Trihelix transcription factor PTL

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03680`	Transcription factor that prevents growth.	No verified direct reference in this release
`At1g76890`	Probable transcription factor that binds specific DNA sequence.	No verified direct reference in this release
`At1g76880`	Transcription repressor that negatively regulates root hair growth by directly binding RSL4 promoter and repressing RSL4 expression.	No verified direct reference in this release
`At1g33240`	Transcription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter.	The trihelix transcription factor GTL1 regulates ploidy-dependent cell growth in the Arabidopsis trichome.2009 · DOI: 10.1105/tpc.109.068387 The Arabidopsis GTL1 transcription factor regulates water use efficiency and drought tolerance by modulating stomatal density via transrepression of SDD1.2010 · DOI: 10.1105/tpc.110.078691 GTL1 and DF1 regulate root hair growth through transcriptional repression of ROOT HAIR DEFECTIVE 6-LIKE 4 in Arabidopsis.2018 · DOI: 10.1242/dev.159707
`At5g28300`	Probable transcription factor that binds specific DNA sequence.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032559 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0046621 negative regulation of organ growth Biological Process

GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process

GO:0048358 mucilage pectin biosynthetic process Biological Process

GO:0048441 petal development Biological Process

GO:0048442 sepal development Biological Process

GO:0048498 establishment of petal orientation Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0090428 perianth development Biological Process

KEGG gene cross-reference

ath:AT1G76880

ath:AT1G76890

ath:AT5G03680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.981

Rank 1 · LXL04_032559 · OH-1004

Cytoplasm0.061

Rank 2 · LXL04_032559 · OH-1004

Cell membrane0.022

Rank 3 · LXL04_032559 · OH-1004

Endoplasmic reticulum0.013

Rank 4 · LXL04_032559 · OH-1004

Plastid0.011

Rank 5 · LXL04_032559 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13837.13Myb_DNA-bind_489-175 aa

PF13837.13Myb_DNA-bind_4346-417 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032559	`PF13837.13`	Myb_DNA-bind_4	89	175	1.8e-32	112.3
LXL04_032559	`PF13837.13`	Myb_DNA-bind_4	346	417	1.8e-32	112.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZS0`	Arabidopsis thaliana	Trihelix transcription factor PTL	39.640%	Swiss-Prot	moderate database homology
`Q39117`	Arabidopsis thaliana	Trihelix transcription factor GT-2	29.979%	Swiss-Prot	weak database homology
`Q9C6K3`	Arabidopsis thaliana	Trihelix transcription factor DF1	29.540%	Swiss-Prot	weak database homology
`Q9C882`	Arabidopsis thaliana	Trihelix transcription factor GTL1	53.271%	Swiss-Prot	weak database homology
`Q8H181`	Arabidopsis thaliana	Trihelix transcription factor GTL2	34.615%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card