TkA08G174020 | RubberDandelionOmics

Gene overview

TkA08G174020

Reference: TK1151 Chr: Chr08 Coordinates: 45522366-45523436 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

885 bp · TkA08G174020|TK1151|cDNA

CTCGAATGTTTTCTCATTTATCAAATTGCACTATTTACGTCTTATTTCATTATTGTATTTGTGTCTAAAATTAAGAAAAATACATTATTCAACTGTTAGACGTGTTATAAAAAACCATTTTGTGGGTCCAACCCACGTGGGCGAACAACGAGATCTCCTAATAAAAAGGCTTTACATCTCCATTCTTTTGGGCAAACCGATCGACGGGAACAGAGAAGATCAAAGATGGTGATGACAATCAACTGCTGTATCAGCCCACG...

CDS

Download CDS FASTA

438 bp · TkA08G174020|TK1151|CDS

ATGGTGATGACAATCAACTGCTGTATCAGCCCACGGCCACCCATAGCTCCTCCGGCCACCATAGCCACCTCCCAACCTCCATCATCCGTCAGACCAAAGAAGGAGGTTTCTTGGAAGAACCAATGTGTAGTTGGGATGGCATGTGTGATAATTGGACTACAAATGGAGGGCATAGTTGGAAATAACCATGACTACGCGGTTGCAATTGAGCCAAAGGTGGCGGTGGAGTCAAAGGCAAAAGGGAGGAGGTGGAGTGGTAA...

Protein

Download Protein FASTA

145 aa · TkA08G174020|TK1151|PROTEIN

MVMTINCCISPRPPIAPPATIATSQPPSSVRPKKEVSWKNQCVVGMACVIIGLQMEGIVGNNHDYAVAIEPKVAVESKAKGRRWSGKRICPAWQLNSLETIVPEDLPRPSHKRRWEEIGDHAKVAPPVKSSTTTITAASSDCFSM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G174020`
TK1151 ID	TkA08G174020
OH-1004 ID	LXL04_032427
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G174020

Location Chr08:45522366-45523436 (+)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25625`	Triggers stress-induced chloroplast degradation, independently of autophagy and senescence-associated vacuoles.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032427 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0010150 leaf senescence Biological Process

GO:1902074 response to salt Biological Process

GO:1904821 chloroplast disassembly Biological Process

GO:0005773 vacuole Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0097708 intracellular vesicle Cellular Component

KEGG gene cross-reference

ath:AT2G25625

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.658

Rank 1 · TkA08G174020 · TK1151

Nucleus0.216

Rank 2 · TkA08G174020 · TK1151

Mitochondrion0.096

Rank 3 · TkA08G174020 · TK1151

Cytoplasm0.073

Rank 4 · TkA08G174020 · TK1151

Cell membrane0.068

Rank 5 · TkA08G174020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S8K8`	Arabidopsis thaliana	sp\|Q8S8K8\|CV_ARATH Protein CHLOROPLAST VESICULATION	47.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card