TkA08G172390 | RubberDandelionOmics

Gene overview

TkA08G172390

Reference: TK1151 Chr: Chr08 Coordinates: 45078846-45079841 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

930 bp · TkA08G172390|TK1151|cDNA

ATGTCTTCTTTGTCTTCCTACAAACACTTTTCTCACTTACAAATCCCACTTGAAGTGATACTATCCGCTACCGACAACTTTTCCGATGCAAATTTCATCAAACGATATGGATTTGTAAAGATATACAAAGCACAACTCTTGGTGTCGGATCAGTTGGTTGATGTTAGTGTTGCACGAAGTTTAGACTCTGAAAATGGTTACGGTATCATAGAATTTTATACAGAGGTTTCGACGCTTTCTAAACTCAATCACAAAAACCT...

CDS

Download CDS FASTA

930 bp · TkA08G172390|TK1151|CDS

ATGTCTTCTTTGTCTTCCTACAAACACTTTTCTCACTTACAAATCCCACTTGAAGTGATACTATCCGCTACCGACAACTTTTCCGATGCAAATTTCATCAAACGATATGGATTTGTAAAGATATACAAAGCACAACTCTTGGTGTCGGATCAGTTGGTTGATGTTAGTGTTGCACGAAGTTTAGACTCTGAAAATGGTTACGGTATCATAGAATTTTATACAGAGGTTTCGACGCTTTCTAAACTCAATCACAAAAACCT...

Protein

Download Protein FASTA

309 aa · TkA08G172390|TK1151|PROTEIN

MSSLSSYKHFSHLQIPLEVILSATDNFSDANFIKRYGFVKIYKAQLLVSDQLVDVSVARSLDSENGYGIIEFYTEVSTLSKLNHKNLVSILGFCDEKGEKIVMRRLEICVGVARALSYIHYDQGRDFSVIHRDIKSSKILLDDKWEAKLSGFDVSLTQTAARRNCLSLTDTWGTPGYCDPTYLKSGTVTHKSDMYSFGVVLFEVLCGKEAITKDKNNMLLASSARSRYEDGKLEDIIDPGLWKQMVLVFSSNLQLNVTVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G172390`
TK1151 ID	TkA08G172390
OH-1004 ID	LXL04_032398
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	65.200
Protein coverage (%)	TK1151 79.288 / OH-1004 19.167 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G172390

Location Chr08:45078846-45079841 (+)

Description Similar to At5g24010: Probable receptor-like protein kinase At5g24010

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
`At2g39360`	Probable receptor-like protein kinase At2g39360.	No verified direct reference in this release
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032398 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009723 response to ethylene Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0030308 negative regulation of cell growth Biological Process

GO:0032922 circadian regulation of gene expression Biological Process

GO:0046777 protein autophosphorylation Biological Process

KEGG gene cross-reference

ath:AT3G51550

ath:AT5G24010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.450

Rank 1 · TkA08G172390 · TK1151

Cell membrane0.321

Rank 2 · TkA08G172390 · TK1151

Nucleus0.276

Rank 3 · TkA08G172390 · TK1151

Endoplasmic reticulum0.071

Rank 4 · TkA08G172390 · TK1151

Golgi apparatus0.048

Rank 5 · TkA08G172390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr38-102 aa

PF00069Pkinase70-100 aa

PF07714PK_Tyr_Ser-Thr104-221 aa

PF00069Pkinase108-288 aa

PF14531Kinase-like126-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G172390	`PF07714`	PK_Tyr_Ser-Thr	38	102	2.1e-20	73.8
TkA08G172390	`PF00069`	Pkinase	70	100	1.2e-23	84.6
TkA08G172390	`PF07714`	PK_Tyr_Ser-Thr	104	221	2.1e-20	73.8
TkA08G172390	`PF00069`	Pkinase	108	288	1.2e-23	84.6
TkA08G172390	`PF14531`	Kinase-like	126	216	0.021	14.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SR05`	Arabidopsis thaliana	sp\|Q9SR05\|ANX1_ARATH Receptor-like protein kinase ANXUR1	39.400%	Swiss-Prot	Medium
`Q3E8W4`	Arabidopsis thaliana	sp\|Q3E8W4\|ANX2_ARATH Receptor-like protein kinase ANXUR2	39.400%	Swiss-Prot	Medium
`Q9SCZ4`	Arabidopsis thaliana	sp\|Q9SCZ4\|FERON_ARATH Receptor-like protein kinase FERONIA	36.900%	Swiss-Prot	Medium
`O80623`	Arabidopsis thaliana	sp\|O80623\|Y2393_ARATH Probable receptor-like protein kinase At2g39360	39.100%	Swiss-Prot	Medium
`Q9FN92`	Arabidopsis thaliana	sp\|Q9FN92\|Y5597_ARATH Probable receptor-like protein kinase At5g59700	37.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card