RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_032398
Reference: OH-1004 Chr: Chr07 Coordinates: 21780953-21788192 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4182 bp · LXL04_032398|LXL04_032398|OH1004|cDNA

atgtcttcttcatcttcCTCCAAAAAGTTTGATCACTTACAAATCCCCCTAGAATTGATAGTATCCGCCACTGACAACTTTTCTGATGCGAACCTTATCGGAGAAGATGGTTTTGGAAAGGAGTACAAAGGTCAACTCTTGTTGTTGTCCGGTCAATTGATTAATATCGTTGCACGGAGGGTAAATCAGCAGATGTACGGACAAGAAAAGAAAGAGTTTTGGATGGAGATTTGGACGCTTTCTAAACTCAAGCATAAAAA...

CDS

Download CDS FASTA

4182 bp · LXL04_032398|LXL04_032398|OH1004|CDS

ATGTCTTCTTCATCTTCCTCCAAAAAGTTTGATCACTTACAAATCCCCCTAGAATTGATAGTATCCGCCACTGACAACTTTTCTGATGCGAACCTTATCGGAGAAGATGGTTTTGGAAAGGAGTACAAAGGTCAACTCTTGTTGTTGTCCGGTCAATTGATTAATATCGTTGCACGGAGGGTAAATCAGCAGATGTACGGACAAGAAAAGAAAGAGTTTTGGATGGAGATTTGGACGCTTTCTAAACTCAAGCATAAAAA...

Protein

Download Protein FASTA

1393 aa · LXL04_032398|LXL04_032398|OH1004|PROTEIN

MSSSSSSKKFDHLQIPLELIVSATDNFSDANLIGEDGFGKEYKGQLLLLSGQLINIVARRVNQQMYGQEKKEFWMEIWTLSKLKHKNIVSVVGFCYKNDEKIVIYKLENHGTLYKYLRDPALTWMQRLQICVGVAHALSYIYYDKQRDFSVIHRDIKSSKILLDDNWEAKLSGFELSITQTAARRNHLFLTDTCSTPEYSDITYIESGSVTHKSDMYSFGMVLFEVLCGKEAITEDKNNMFIASSARSHYEGGKLEDMID...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_032398
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_032398
LocationChr07:21780953-21788192 (+)
DescriptionSimilar to At5g24010: Probable receptor-like protein kinase At5g24010
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g24010 Probable receptor-like protein kinase At5g24010. No verified direct reference in this release
At3g51550 May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.
FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
At5g28680 Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell. No verified direct reference in this release
At3g04690 Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell. No verified direct reference in this release
At3g46290 Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.
Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032398 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0009723 response to ethylene Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009741 response to brassinosteroid Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0009873 ethylene-activated signaling pathway Biological Process
GO:0010118 stomatal movement Biological Process
GO:0010483 pollen tube reception Biological Process
GO:0030308 negative regulation of cell growth Biological Process
GO:0032922 circadian regulation of gene expression Biological Process
GO:0046777 protein autophosphorylation Biological Process
KEGG gene cross-reference
ath:AT3G51550
ath:AT5G24010
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.504
Rank 1 · LXL04_032398 · OH-1004
Cell membrane0.342
Rank 2 · LXL04_032398 · OH-1004
Nucleus0.281
Rank 3 · LXL04_032398 · OH-1004
Endoplasmic reticulum0.054
Rank 4 · LXL04_032398 · OH-1004
Lysosome / Vacuole0.044
Rank 5 · LXL04_032398 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr32-299 aa
PF00069.32Pkinase57-297 aa
PF07714.24PK_Tyr_Ser-Thr353-660 aa
PF00069.32Pkinase388-658 aa
PF00069.32Pkinase690-959 aa
PF07714.24PK_Tyr_Ser-Thr692-960 aa
PF14299.14PP21041-1148 aa
PF14299.14PP21229-1392 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_032398PF07714.24PK_Tyr_Ser-Thr322998.3e-113376.7
LXL04_032398PF00069.32Pkinase572977.8e-109363.8
LXL04_032398PF07714.24PK_Tyr_Ser-Thr3536608.3e-113376.7
LXL04_032398PF00069.32Pkinase3886587.8e-109363.8
LXL04_032398PF00069.32Pkinase6909597.8e-109363.8
LXL04_032398PF07714.24PK_Tyr_Ser-Thr6929608.3e-113376.7
LXL04_032398PF14299.14PP2104111481.2e-41142.9
LXL04_032398PF14299.14PP2122913921.2e-41142.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FLW0Arabidopsis thalianaProbable receptor-like protein kinase At5g2401039.873%Swiss-Protweak database homology
Q9SCZ4Arabidopsis thalianaReceptor-like protein kinase FERONIA38.438%Swiss-Protweak database homology
Q3E8W4Arabidopsis thalianaReceptor-like protein kinase ANXUR237.015%Swiss-Protweak database homology
Q9SR05Arabidopsis thalianaReceptor-like protein kinase ANXUR137.313%Swiss-Protweak database homology
Q9LX66Arabidopsis thalianaReceptor-like protein kinase HERK 138.762%Swiss-Protweak database homology

JBrowse

View in Genome Browser