RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA08G170970
Reference: TK1151 Chr: Chr08 Coordinates: 44741245-44746239 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2307 bp · TkA08G170970|TK1151|cDNA

ATGGACGAAATATATGAAAAGACTAAAGGTGTGACCCACAAGGTGGATGTGTTTGCCTTCGGTGTGGTCCTATTTGAAGTTTTGTTTGGGTGTGAAGCATGGAGTGCGGAAGACGATGATGTGGATGGGGAGTCTTTAGTACAATCGGCCAGATGTCATTATCAAAAGGGGACATTGGAAGATATGATTGATAATGAACTTAGGGAAGAAATGGACGAGCAATCGTTGAAGATCTTCTCAGAAACAGCGTTTTATTGTTT...

CDS

Download CDS FASTA

2307 bp · TkA08G170970|TK1151|CDS

ATGGACGAAATATATGAAAAGACTAAAGGTGTGACCCACAAGGTGGATGTGTTTGCCTTCGGTGTGGTCCTATTTGAAGTTTTGTTTGGGTGTGAAGCATGGAGTGCGGAAGACGATGATGTGGATGGGGAGTCTTTAGTACAATCGGCCAGATGTCATTATCAAAAGGGGACATTGGAAGATATGATTGATAATGAACTTAGGGAAGAAATGGACGAGCAATCGTTGAAGATCTTCTCAGAAACAGCGTTTTATTGTTT...

Protein

Download Protein FASTA

768 aa · TkA08G170970|TK1151|PROTEIN

MDEIYEKTKGVTHKVDVFAFGVVLFEVLFGCEAWSAEDDDVDGESLVQSARCHYQKGTLEDMIDNELREEMDEQSLKIFSETAFYCLKEQRSQRPNMDQIIKRLEKALGLQMKFENHVRVYDRNVYHILQRKDLEHLKIKLSDLEFATENFSEIFCIGSGGYGKVYKAELNLDDKSKVVAIKSIFSRADKQGEDGFIAEIEMLSSCKNRNIVSLLGFCDEGPQQILVYEYVSNGSLDDYLGSTDNMTNLTWMQRIKICLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA08G170970
TK1151 IDTkA08G170970
OH-1004 IDLXL04_032394
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)94.100
Protein coverage (%)TK1151 97.396 / OH-1004 56.137
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA08G170970
LocationChr08:44741245-44746239 (+)
DescriptionSimilar to At5g59700: Probable receptor-like protein kinase At5g59700
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g28680 Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell. No verified direct reference in this release
At3g51550 May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.
FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
At2g23200 Probable receptor-like protein kinase At2g23200. No verified direct reference in this release
At5g59700 Probable receptor-like protein kinase At5g59700. No verified direct reference in this release
At3g46290 Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.
Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_032394 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0010183 pollen tube guidance Biological Process
GO:0010483 pollen tube reception Biological Process
GO:0051924 regulation of calcium ion transport Biological Process
GO:0080147 root hair cell development Biological Process
GO:0097275 intracellular ammonium homeostasis Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009506 plasmodesma Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0009705 plant-type vacuole membrane Cellular Component
GO:0043680 filiform apparatus Cellular Component
GO:0004672 protein kinase activity Molecular Function
KEGG gene cross-reference
ath:AT5G59700
ath:AT5G61350
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.503
Rank 1 · TkA08G170970 · TK1151
Cell membrane0.407
Rank 2 · TkA08G170970 · TK1151
Nucleus0.238
Rank 3 · TkA08G170970 · TK1151
Golgi apparatus0.053
Rank 4 · TkA08G170970 · TK1151
Endoplasmic reticulum0.050
Rank 5 · TkA08G170970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase7-102 aa
PF07714PK_Tyr_Ser-Thr8-104 aa
PF25068ARM_TT21_4th60-144 aa
PF17748VID27_N61-98 aa
PF17275DUF534075-125 aa
PF00069Pkinase156-439 aa
PF03109ABC1156-182 aa
PF07714PK_Tyr_Ser-Thr157-367 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA08G170970PF00069Pkinase71025.5e-79266.0
TkA08G170970PF07714PK_Tyr_Ser-Thr81041.5e-89300.5
TkA08G170970PF25068ARM_TT21_4th601440.1313.2
TkA08G170970PF17748VID27_N61980.01515.9
TkA08G170970PF17275DUF5340751250.0002621.8
TkA08G170970PF00069Pkinase1564395.5e-79266.0
TkA08G170970PF03109ABC11561820.01115.6
TkA08G170970PF07714PK_Tyr_Ser-Thr1573671.5e-89300.5
TkA08G170970PF03109ABC12243120.01115.6
TkA08G170970PF17667Pkinase_fungal2693520.005216.3
TkA08G170970PF17748VID27_N3964440.01515.9
TkA08G170970PF07714PK_Tyr_Ser-Thr4194421.5e-89300.5
TkA08G170970PF17275DUF53404244510.0002621.8
TkA08G170970PF25068ARM_TT21_4th4244630.1313.2
TkA08G170970PF07714PK_Tyr_Ser-Thr4827381.5e-89300.5
TkA08G170970PF00069Pkinase4937385.5e-79266.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q3E8W4Arabidopsis thalianasp|Q3E8W4|ANX2_ARATH Receptor-like protein kinase ANXUR242.200%Swiss-ProtLow
Q9SCZ4Arabidopsis thalianasp|Q9SCZ4|FERON_ARATH Receptor-like protein kinase FERONIA37.200%Swiss-ProtLow
O22187Arabidopsis thalianasp|O22187|Y2232_ARATH Probable receptor-like protein kinase At2g2320044.400%Swiss-ProtLow
Q9FN92Arabidopsis thalianasp|Q9FN92|Y5597_ARATH Probable receptor-like protein kinase At5g5970040.700%Swiss-ProtLow
Q9LX66Arabidopsis thalianasp|Q9LX66|HERK_ARATH Receptor-like protein kinase HERK 142.500%Swiss-ProtLow

JBrowse

View in Genome Browser