TkA08G170630 | RubberDandelionOmics

Gene overview

TkA08G170630

Reference: TK1151 Chr: Chr08 Coordinates: 44613035-44614668 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1259 bp · TkA08G170630|TK1151|cDNA

ATGAAAGTGGCCTTTATGCATCTCTAGTTCATATGTCACAGCAGTTCAGCCATGGCAGATACTCCAACTCATTGCTTCAAGTTCATCCGTCCAGGCTTCAAATTTGACCTCTCGATACCAAGCTCGTTCTTGATGAACCTGAACGGAGGTAGATGCTCAGAAGTGACACTGAGGCGCGAGCGTCACGTATGGTCGGTGGCCATTGACGACGGCGTCTTTGGTGACGGTTGGAGGATGTTTTTGAGAGAGAATGGAGTGCA...

CDS

Download CDS FASTA

1017 bp · TkA08G170630|TK1151|CDS

ATGGCAGATACTCCAACTCATTGCTTCAAGTTCATCCGTCCAGGCTTCAAATTTGACCTCTCGATACCAAGCTCGTTCTTGATGAACCTGAACGGAGGTAGATGCTCAGAAGTGACACTGAGGCGCGAGCGTCACGTATGGTCGGTGGCCATTGACGACGGCGTCTTTGGTGACGGTTGGAGGATGTTTTTGAGAGAGAATGGAGTGCAAGAGTTTGACTTTATTGTGTTTAAACATCAAGGAGGCATGATGTTTGACTT...

Protein

Download Protein FASTA

338 aa · TkA08G170630|TK1151|PROTEIN

MADTPTHCFKFIRPGFKFDLSIPSSFLMNLNGGRCSEVTLRRERHVWSVAIDDGVFGDGWRMFLRENGVQEFDFIVFKHQGGMMFDFLVFDQSTCERQYPNISDEMDVEERPVTVSETIRTNTSSTLNSHPYFISNLKPSSFKKSFLHLPSHFMKGSGLKTGEMILIDDEDRSWKVQLNKVKKDNEFYHLGIGLRAFLVANEYKVGDAFKFEVLEKEKKKPPVVKFSCTYGLTPTKEDGRRYFMCELNSRNIQHSALYLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G170630`
TK1151 ID	TkA08G170630
OH-1004 ID	LXL04_032382
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G170630

Location Chr08:44613035-44614668 (+)

Description Similar to REM10: B3 domain-containing protein REM10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31680`	B3 domain-containing protein REM8.	No verified direct reference in this release
`At4g31690`	B3 domain-containing protein REM9.	No verified direct reference in this release
`At2g24700`	B3 domain-containing protein REM10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032382 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010601 positive regulation of auxin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G24645

ath:AT2G24700

ath:AT4G00260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · TkA08G170630 · TK1151

Cytoplasm0.084

Rank 2 · TkA08G170630 · TK1151

Cell membrane0.024

Rank 3 · TkA08G170630 · TK1151

Endoplasmic reticulum0.020

Rank 4 · TkA08G170630 · TK1151

Plastid0.008

Rank 5 · TkA08G170630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362B317-88 aa

PF03754At2g31720-like55-85 aa

PF02362B3136-226 aa

PF04014MazE_antitoxin149-172 aa

PF03754At2g31720-like163-210 aa

PF02362B3247-328 aa

PF04014MazE_antitoxin258-283 aa

PF03754At2g31720-like275-318 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G170630	`PF02362`	B3	17	88	1.4e-41	141.2
TkA08G170630	`PF03754`	At2g31720-like	55	85	4e-05	24.1
TkA08G170630	`PF02362`	B3	136	226	1.4e-41	141.2
TkA08G170630	`PF04014`	MazE_antitoxin	149	172	0.012	16.2
TkA08G170630	`PF03754`	At2g31720-like	163	210	4e-05	24.1
TkA08G170630	`PF02362`	B3	247	328	1.4e-41	141.2
TkA08G170630	`PF04014`	MazE_antitoxin	258	283	0.012	16.2
TkA08G170630	`PF03754`	At2g31720-like	275	318	4e-05	24.1
TkA08G170630	`PF04014`	MazE_antitoxin	304	325	0.012	16.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H2D1`	Arabidopsis thaliana	sp\|Q8H2D1\|REM8_ARATH B3 domain-containing protein REM8	27.700%	Swiss-Prot	Low
`O81778`	Arabidopsis thaliana	sp\|O81778\|REM9_ARATH B3 domain-containing protein REM9	26.200%	Swiss-Prot	Low
`P0DH85`	Arabidopsis thaliana	sp\|P0DH85\|REM10_ARATH B3 domain-containing protein REM10	26.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card