LXL04_032382 | RubberDandelionOmics

Gene overview

LXL04_032382

Reference: OH-1004 Chr: Chr07 Coordinates: 21599406-21600837 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1017 bp · LXL04_032382|LXL04_032382|OH1004|cDNA

ATGGCAGATACTCCAACTCATTGCTTCAAGTTCATCCGTCCAGGCTTCAAATTTGACCTCTCGATACCAAGCTCGTTCTTGATGAACCTGAACGGAGGTAGATGCTCAGAAGTGACACTGAGGCGCGAGCGTCACGTATGGTCGGTGGCCATTGACGACGGCGTCTTTGGTGACGGTTGGAGGATGTTTTTGAGAGAGAATGGAGTGCAAGAGTTTGACTTTATTGTGTTTAAACATCAAGGAGGCATGATGTTTGACTT...

CDS

Download CDS FASTA

1017 bp · LXL04_032382|LXL04_032382|OH1004|CDS

ATGGCAGATACTCCAACTCATTGCTTCAAGTTCATCCGTCCAGGCTTCAAATTTGACCTCTCGATACCAAGCTCGTTCTTGATGAACCTGAACGGAGGTAGATGCTCAGAAGTGACACTGAGGCGCGAGCGTCACGTATGGTCGGTGGCCATTGACGACGGCGTCTTTGGTGACGGTTGGAGGATGTTTTTGAGAGAGAATGGAGTGCAAGAGTTTGACTTTATTGTGTTTAAACATCAAGGAGGCATGATGTTTGACTT...

Protein

Download Protein FASTA

338 aa · LXL04_032382|LXL04_032382|OH1004|PROTEIN

MADTPTHCFKFIRPGFKFDLSIPSSFLMNLNGGRCSEVTLRRERHVWSVAIDDGVFGDGWRMFLRENGVQEFDFIVFKHQGGMMFDFLVFDQSTCERQYPNISDEMDVEERPVTVSETIRTNTSSTLNSHPYFISNLKPSSFKKSFLHLPSHFMKGSGLKTGEMILIDDEDRSWKVQLNKVKKDNEFYHLGIGLRAFLVANEYKVGDAFKFEVLEKEKKKPPVVKFSCTYGLTPTKEDGRRYFMCELNSRNIQHSALYLP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032382`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032382

Location Chr07:21599406-21600837 (+)

Description Similar to REM10: B3 domain-containing protein REM10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24700`	B3 domain-containing protein REM10.	No verified direct reference in this release
`At2g24645`	B3 domain-containing protein REM14.	No verified direct reference in this release
`At4g00260`	Putative B3 domain-containing protein REM15.	No verified direct reference in this release
`At4g31680`	B3 domain-containing protein REM8.	No verified direct reference in this release
`At4g31690`	B3 domain-containing protein REM9.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032382 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010601 positive regulation of auxin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G24645

ath:AT2G24700

ath:AT4G00260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · LXL04_032382 · OH-1004

Cytoplasm0.084

Rank 2 · LXL04_032382 · OH-1004

Cell membrane0.024

Rank 3 · LXL04_032382 · OH-1004

Endoplasmic reticulum0.020

Rank 4 · LXL04_032382 · OH-1004

Plastid0.008

Rank 5 · LXL04_032382 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02362.27B317-88 aa

PF02362.27B3136-226 aa

PF02362.27B3247-328 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032382	`PF02362.27`	B3	17	88	1.4e-41	141.2
LXL04_032382	`PF02362.27`	B3	136	226	1.4e-41	141.2
LXL04_032382	`PF02362.27`	B3	247	328	1.4e-41	141.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P0DH85`	Arabidopsis thaliana	B3 domain-containing protein REM10	27.374%	Swiss-Prot	weak database homology
`Q8GYM4`	Arabidopsis thaliana	B3 domain-containing protein REM14	28.190%	Swiss-Prot	weak database homology
`O23076`	Arabidopsis thaliana	Putative B3 domain-containing protein REM15	26.075%	Swiss-Prot	weak database homology
`Q8H2D1`	Arabidopsis thaliana	B3 domain-containing protein REM8	28.571%	Swiss-Prot	weak database homology
`O81778`	Arabidopsis thaliana	B3 domain-containing protein REM9	26.513%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card