TkA08G168750 | RubberDandelionOmics

Gene overview

TkA08G168750

Reference: TK1151 Chr: Chr08 Coordinates: 44117198-44121833 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2687 bp · TkA08G168750|TK1151|cDNA

CAACGATGACCATTTATATTTACTGCAAATTTGTTTCTCTTGACATTTAATTAAGCAAAGCCGCTACAGGATCCAGCGGGTTTGCATGCCACATTGTTGTACCACGACGGTTGCGCCGCTCAGCATTACTTACAACCACCGTCCCCCGGCAGTCTATCTATCCGTTTTCCATCTAGAATCAAATGAAAATGGACGAGCAAGATGGAACCGATTGAACGATGCATCTAAACGTAAATAAAAATGTATACTGAAAATAACCC...

CDS

Download CDS FASTA

1989 bp · TkA08G168750|TK1151|CDS

ATGGACACCCCTAAAACTCCCTTCAGTGGGATCAAAAAAGATATCCATGGAAGATTACAGTGTTACAAACAAGATTGGGTCAGAGCTCTAGATTCAGGCGCAAGAATATTAGCTCCAACAGCATACATTTTCTTTGCCTCCACCCTTCCAGTCATTGCATTCGGTGAACAACTAAATAAAGAAACAGATGACACCTTAAGTGCTGTAGAAACTCTCACATCAACTGCTATTTGTGGAATCATCCATGCAATATTCGGTGG...

Protein

Download Protein FASTA

662 aa · TkA08G168750|TK1151|PROTEIN

MDTPKTPFSGIKKDIHGRLQCYKQDWVRALDSGARILAPTAYIFFASTLPVIAFGEQLNKETDDTLSAVETLTSTAICGIIHAIFGGQPLLILGVAEPTVIMYNYLYAFAKKRPELGKHLFLAWAGWVCVWTAVMLCVLAILNACTLITRFTRVAGELFGMLISVLFMQEAIKGVLSEFYVPKGENETLEEYQFHWLYTNGLLAIILAFGTLMTSMKSRGARSWPYGVGWIRGFIADYGVPLMVLVWTGISYAKPREVPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G168750`
TK1151 ID	TkA08G168750
OH-1004 ID	LXL04_008547
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.700
Protein coverage (%)	TK1151 97.130 / OH-1004 94.064 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G168750

Location Chr08:44117198-44121833 (+)

Description Similar to BOR4: Boron transporter 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32510`	Putative boron transporter.	No verified direct reference in this release
`At5g25430`	Probable boron transporter.	No verified direct reference in this release
`At1g15460`	Efflux-type boron transporter polarly localized in roots.	Plants tolerant of high boron levels.2007 · DOI: 10.1126/science.1146634
`At1g74810`	Putative boron transporter.	No verified direct reference in this release
`At2g47160`	Efflux-type boron (B) transporter for xylem loading, responsive of boron translocation from roots to shoots under boron limitation.	Arabidopsis boron transporter for xylem loading.2002 · DOI: 10.1038/nature01139 Improvement of seed yields under boron-limiting conditions through overexpression of BOR1, a boron transporter for xylem loading, in Arabidopsis thaliana.2006 · DOI: 10.1111/j.1365-313x.2006.02763.x DRP1-Dependent Endocytosis is Essential for Polar Localization and Boron-Induced Degradation of the Borate Transporter BOR1 in Arabidopsis thaliana.2016 · DOI: 10.1093/pcp/pcw121 bor1-1, an Arabidopsis thaliana mutant that requires a high level of boron.1997 · DOI: 10.1104/pp.115.3.901

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008547 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006820 monoatomic anion transport Biological Process

GO:0046713 borate transport Biological Process

GO:0048364 root development Biological Process

GO:0050801 monoatomic ion homeostasis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0080029 cellular response to boron-containing substance levels Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005452 solute:inorganic anion antiporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G15460

ath:AT1G74810

ath:AT3G62270

ath:AT4G32510

ath:AT5G25430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.717

Rank 1 · TkA08G168750 · TK1151

Cytoplasm0.135

Rank 2 · TkA08G168750 · TK1151

Endoplasmic reticulum0.119

Rank 3 · TkA08G168750 · TK1151

Lysosome / Vacuole0.077

Rank 4 · TkA08G168750 · TK1151

Golgi apparatus0.063

Rank 5 · TkA08G168750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00955HCO3_cotransp7-181 aa

PF00955HCO3_cotransp195-375 aa

PF00955HCO3_cotransp448-590 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G168750	`PF00955`	HCO3_cotransp	7	181	5.6e-99	333.0
TkA08G168750	`PF00955`	HCO3_cotransp	195	375	5.6e-99	333.0
TkA08G168750	`PF00955`	HCO3_cotransp	448	590	5.6e-99	333.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUU1`	Arabidopsis thaliana	sp\|Q9SUU1\|BOR7_ARATH Probable boron transporter 7	63.900%	Swiss-Prot	High
`Q3E954`	Arabidopsis thaliana	sp\|Q3E954\|BOR6_ARATH Probable boron transporter 6	64.400%	Swiss-Prot	High
`Q9XI23`	Arabidopsis thaliana	sp\|Q9XI23\|BOR4_ARATH Boron transporter 4	63.800%	Swiss-Prot	High
`Q9SSG5`	Arabidopsis thaliana	sp\|Q9SSG5\|BOR5_ARATH Putative boron transporter 5	62.000%	Swiss-Prot	High
`Q8VYR7`	Arabidopsis thaliana	sp\|Q8VYR7\|BOR1_ARATH Boron transporter 1	57.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card