LXL04_008547 | RubberDandelionOmics

Gene overview

LXL04_008547

Reference: OH-1004 Chr: Chr02 Coordinates: 102398929-102402238 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1974 bp · LXL04_008547|LXL04_008547|OH1004|cDNA

ATGTGTTTTGTTAACGTTGATAACTTGATAGACATTTATGCAATTTCAGGAATGGATCATTTGAAATCTCCATTCAGAGGGATTGCACAGGATGTTAGAGGAAGAGCATTGTGCTATAAACAGGATTGGATTGCCGGTATTCGCTCTGGATTAGGGATATTGGCTCCAACTACATACATCTTCTTTGCTTCTGCACTACCGGTCATTGCATTTGGGGAGCAACTTAGTAGAGATACAGATGGAAGCTTGAGTACTGTTGA...

CDS

Download CDS FASTA

1974 bp · LXL04_008547|LXL04_008547|OH1004|CDS

ATGTGTTTTGTTAACGTTGATAACTTGATAGACATTTATGCAATTTCAGGAATGGATCATTTGAAATCTCCATTCAGAGGGATTGCACAGGATGTTAGAGGAAGAGCATTGTGCTATAAACAGGATTGGATTGCCGGTATTCGCTCTGGATTAGGGATATTGGCTCCAACTACATACATCTTCTTTGCTTCTGCACTACCGGTCATTGCATTTGGGGAGCAACTTAGTAGAGATACAGATGGAAGCTTGAGTACTGTTGA...

Protein

Download Protein FASTA

657 aa · LXL04_008547|LXL04_008547|OH1004|PROTEIN

MCFVNVDNLIDIYAISGMDHLKSPFRGIAQDVRGRALCYKQDWIAGIRSGLGILAPTTYIFFASALPVIAFGEQLSRDTDGSLSTVETLTSTAICGIIHSILGGQPLLILGVAEPTVIMYTYLYNFAKGRQDLGQKLFLAWAGWVCTWTALMLFLLAIFNACVIINRFTRIAGETFGLLISVLFIQEAIKGLVSEYKIPKNEEPNKVKYQFQWLYTNGMLAIVFSFGLLYTAMKSRKARSWWFGTGRLRSFIADYGVPLM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008547`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008547

Location Chr02:102398929-102402238 (+)

Description Similar to BOR4: Boron transporter 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15460`	Efflux-type boron transporter polarly localized in roots.	Plants tolerant of high boron levels.2007 · DOI: 10.1126/science.1146634
`At1g74810`	Putative boron transporter.	No verified direct reference in this release
`At4g32510`	Putative boron transporter.	No verified direct reference in this release
`At5g25430`	Probable boron transporter.	No verified direct reference in this release
`At3g62270`	Probable boron transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008547 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006820 monoatomic anion transport Biological Process

GO:0046713 borate transport Biological Process

GO:0048364 root development Biological Process

GO:0050801 monoatomic ion homeostasis Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0080029 cellular response to boron-containing substance levels Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0005452 solute:inorganic anion antiporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G15460

ath:AT1G74810

ath:AT3G62270

ath:AT4G32510

ath:AT5G25430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.420

Rank 1 · LXL04_008547 · OH-1004

Lysosome / Vacuole0.226

Rank 2 · LXL04_008547 · OH-1004

Endoplasmic reticulum0.198

Rank 3 · LXL04_008547 · OH-1004

Cytoplasm0.128

Rank 4 · LXL04_008547 · OH-1004

Golgi apparatus0.108

Rank 5 · LXL04_008547 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00955.28HCO3_cotransp24-204 aa

PF00955.28HCO3_cotransp219-361 aa

PF00955.28HCO3_cotransp440-582 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008547	`PF00955.28`	HCO3_cotransp	24	204	2e-84	285.0
LXL04_008547	`PF00955.28`	HCO3_cotransp	219	361	2e-84	285.0
LXL04_008547	`PF00955.28`	HCO3_cotransp	440	582	2e-84	285.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XI23`	Arabidopsis thaliana	Boron transporter 4	67.359%	Swiss-Prot	strong database homology
`Q9SSG5`	Arabidopsis thaliana	Putative boron transporter 5	67.015%	Swiss-Prot	strong database homology
`Q9SUU1`	Arabidopsis thaliana	Probable boron transporter 7	62.293%	Swiss-Prot	strong database homology
`Q3E954`	Arabidopsis thaliana	Probable boron transporter 6	62.212%	Swiss-Prot	strong database homology
`Q9M1P7`	Arabidopsis thaliana	Probable boron transporter 2	54.824%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card