TkA08G167600 | RubberDandelionOmics

Gene overview

TkA08G167600

Reference: TK1151 Chr: Chr08 Coordinates: 43808434-43809668 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

564 bp · TkA08G167600|TK1151|cDNA

ATGGTGGTTCACCGAGATCTTAAGCATGCAAGTTTACTTCTTAACTCAAAGGGAAATGGCAAAATTACTTACTTTGGACTAGCCAATCTCATGCGAGATGGCCATGTTCTGGAAACAAGTTGTGGAAGCCCTAATTATGCTTTTATAGAGGTTATACCTGAATGTCAGTTTGAAGCCTCTAAGTTGATGTCTGGACTTGTGGAGAACATCTTCCACAATACAATGCAGGCCACTCAATTGATATTTAATGGAGTCCAAGA...

CDS

Download CDS FASTA

564 bp · TkA08G167600|TK1151|CDS

ATGGTGGTTCACCGAGATCTTAAGCATGCAAGTTTACTTCTTAACTCAAAGGGAAATGGCAAAATTACTTACTTTGGACTAGCCAATCTCATGCGAGATGGCCATGTTCTGGAAACAAGTTGTGGAAGCCCTAATTATGCTTTTATAGAGGTTATACCTGAATGTCAGTTTGAAGCCTCTAAGTTGATGTCTGGACTTGTGGAGAACATCTTCCACAATACAATGCAGGCCACTCAATTGATATTTAATGGAGTCCAAGA...

Protein

Download Protein FASTA

187 aa · TkA08G167600|TK1151|PROTEIN

MVVHRDLKHASLLLNSKGNGKITYFGLANLMRDGHVLETSCGSPNYAFIEVIPECQFEASKLMSGLVENIFHNTMQATQLIFNGVQERYKQVDVRGLEEMAILGFDVEEVIGSLNNFLKNMVPKLSKATVTYSILLHMVLSNHNYNKNNLCHHNAQIAEKFIIGLERNHVDMGGMAGLELVESSTVV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G167600`
TK1151 ID	TkA08G167600
OH-1004 ID	LXL04_036177
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	41.900
Protein coverage (%)	TK1151 80.214 / OH-1004 42.480 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G167600

Location Chr08:43808434-43809668 (+)

Description Similar to KIN10: SNF1-related protein kinase catalytic subunit alpha KIN10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01090`	Catalytic subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, a central regulator of cellular energy homeostasis, which, in response to seemingly unrelated darkness, sugar and stress conditions, activates energy-producing pathways and inhibits energy-consuming processes.	Regulatory interaction of PRL1 WD protein with Arabidopsis SNF1-like protein kinases.1999 · DOI: 10.1073/pnas.96.9.5322 A central integrator of transcription networks in plant stress and energy signalling.2007 · DOI: 10.1038/nature06069 Cross-phosphorylation between Arabidopsis thaliana sucrose nonfermenting 1-related protein kinase 1 (AtSnRK1) and its activating kinase (AtSnAK) determines their catalytic activities.2010 · DOI: 10.1074/jbc.m109.079194 AKIN10 and FUSCA3 interact to control lateral organ development and phase transitions in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2011.04832.x Overlapping and distinct roles of AKIN10 and FUSCA3 in ABA and sugar signaling during seed germination.2012 · DOI: 10.4161/psb.21549 Inverse modulation of the energy sensor Snf1-related protein kinase 1 on hypoxia adaptation and salt stress tolerance in Arabidopsis thaliana.2014 · DOI: 10.1111/pce.12375 AKIN10 delays flowering by inactivating IDD8 transcription factor through protein phosphorylation in Arabidopsis.2015 · DOI: 10.1186/s12870-015-0503-8 Quantitative phosphoproteomics of protein kinase SnRK1 regulated protein phosphorylation in Arabidopsis under submergence.2016 · DOI: 10.1093/jxb/erw107 AKIN10, a representative Arabidopsis SNF1-related protein kinase 1 (SnRK1), phosphorylates and downregulates plant HMG-CoA reductase.2017 · DOI: 10.1002/1873-3468.12618 Phosphorylation of WRINKLED1 by KIN10 Results in Its Proteasomal Degradation, Providing a Link between Energy Homeostasis and Lipid Biosynthesis.2017 · DOI: 10.1105/tpc.17.00019 The AMP-Activated Protein Kinase KIN10 Is Involved in the Regulation of Autophagy in Arabidopsis .2017 · DOI: 10.3389/fpls.2017.01201 SnRK1 activates autophagy via the TOR signaling pathway in Arabidopsis thaliana.2017 · DOI: 10.1371/journal.pone.0182591 SnRK1 phosphorylation of FUSCA3 positively regulates embryogenesis, seed yield, and plant growth at high temperature in Arabidopsis.2017 · DOI: 10.1093/jxb/erx233 The Energy-Signaling Hub SnRK1 Is Important for Sucrose-Induced Hypocotyl Elongation.2018 · DOI: 10.1104/pp.17.01395 The Role of Arabidopsis Inositol Polyphosphate Kinase AtIPK2β in Glucose Suppression of Seed Germination and Seedling Development.2018 · DOI: 10.1093/pcp/pcx186 Involvement of the SnRK1 subunit KIN10 in sucrose-induced hypocotyl elongation.2018 · DOI: 10.1080/15592324.2018.1457913
`At3g29160`	Catalytic subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, a central regulator of cellular energy homeostasis, which, in response to seemingly unrelated darkness, sugar and stress conditions, activates energy-producing pathways and inhibits energy-consuming processes.	Regulatory interaction of PRL1 WD protein with Arabidopsis SNF1-like protein kinases.1999 · DOI: 10.1073/pnas.96.9.5322 A central integrator of transcription networks in plant stress and energy signalling.2007 · DOI: 10.1038/nature06069
`At5g57630`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0530500`	Serine/threonine-protein kinase involved in sugar signaling during germination and seedling growth.	The SnRK1A protein kinase plays a key role in sugar signaling during germination and seedling growth of rice.2007 · DOI: 10.1105/tpc.105.037887
`Os06g0606000`	May regulate intracellular Na⁺/K⁺ homeostasis and salt tolerance.	Conservation of the salt overly sensitive pathway in rice.2007 · DOI: 10.1104/pp.106.092635

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036177 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0003006 developmental process involved in reproduction Biological Process

GO:0005982 starch metabolic process Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009594 detection of nutrient Biological Process

GO:0009635 response to herbicide Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009743 response to carbohydrate Biological Process

GO:0009749 response to glucose Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT3G01090

ath:AT3G29160

dosa:Os05g0530500

dosa:Os08g0484600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.426

Rank 1 · TkA08G167600 · TK1151

Nucleus0.297

Rank 2 · TkA08G167600 · TK1151

Mitochondrion0.134

Rank 3 · TkA08G167600 · TK1151

Cell membrane0.120

Rank 4 · TkA08G167600 · TK1151

Endoplasmic reticulum0.098

Rank 5 · TkA08G167600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase2-57 aa

PF07714PK_Tyr_Ser-Thr2-35 aa

PF15005IZUMO54-160 aa

PF22442Gp49_Pectate_lyase_like63-177 aa

PF03806ABG_transport76-144 aa

PF07714PK_Tyr_Ser-Thr112-158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G167600	`PF00069`	Pkinase	2	57	1.6e-09	38.3
TkA08G167600	`PF07714`	PK_Tyr_Ser-Thr	2	35	0.0037	17.3
TkA08G167600	`PF15005`	IZUMO	54	160	0.23	12.8
TkA08G167600	`PF22442`	Gp49_Pectate_lyase_like	63	177	0.069	13.2
TkA08G167600	`PF03806`	ABG_transport	76	144	0.0088	15.1
TkA08G167600	`PF07714`	PK_Tyr_Ser-Thr	112	158	0.0037	17.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q38997`	Arabidopsis thaliana	sp\|Q38997\|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10	73.100%	Swiss-Prot	Low
`P92958`	Arabidopsis thaliana	sp\|P92958\|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11	71.200%	Swiss-Prot	Low
`Q94CG0`	Arabidopsis thaliana	sp\|Q94CG0\|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21	52.900%	Swiss-Prot	Low
`Q852Q2`	Oryza sativa subsp. japonica	sp\|Q852Q2\|OSK1_ORYSJ Serine/threonine protein kinase OSK1	73.100%	Swiss-Prot	Low
`Q69Q47`	Oryza sativa subsp. japonica	sp\|Q69Q47\|CIPKO_ORYSJ CBL-interacting protein kinase 24	46.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card