TkA08G165750 | RubberDandelionOmics

Gene overview

TkA08G165750

Reference: TK1151 Chr: Chr08 Coordinates: 43329418-43333096 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2604 bp · TkA08G165750|TK1151|cDNA

AAGTAACCCAACGCAGGTCCTCTTTCTCCTCCATCTCGTCCATGTTGAAATTGTTCTTCTCTCCATCTTCGATCAAAACCTCTCAACGCATGCACCGACACATTTTCCGTCTTTTTCCACAACAATCTCAGATTGGATCAATATATTAACAGGCAGGTTTACTGCCGATATCAATGGAGACTCAAACTAGACCTGCAACTTCTAAGTTTTTCTTCCTTCTTCCTCGGAATTTGCTGTTAGCATATCAAAGCTTGGCGTTG...

CDS

Download CDS FASTA

648 bp · TkA08G165750|TK1151|CDS

ATGCGTGAAATACGTTCCGATCTCCGTTTGTGTTACCGACGGATACGTTACCTCATCGGCCGTGTATGCCCTAGGCCGTATCGTATGTACCGGTGCATCGTCAGATACGGTTATAAAGACATCCAGAAAGACGATCGAAACTTCGAGAATCAATTGATTCAAAGCGTAGCAGAGTTTATACAAATGGAAGCGGTTCAACCTCCGCCACCGACATCCGATACCGGATCCTTCGACGGGCGAATGGCGGTGATAAGCACCAA...

Protein

Download Protein FASTA

215 aa · TkA08G165750|TK1151|PROTEIN

MREIRSDLRLCYRRIRYLIGRVCPRPYRMYRCIVRYGYKDIQKDDRNFENQLIQSVAEFIQMEAVQPPPPTSDTGSFDGRMAVISTKSNSGLIISESEPGESIIRSSALRILKSSYDAENPQMSRRRVRFQLPPSSPAMDPAVRDELLQLVEAKEAGVAYITGFSYIKARKASSILKKFVIDVGYSFLRKNCRRPAVTLHIPHISLIEVGMIYYV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G165750`
TK1151 ID	TkA08G165750
OH-1004 ID	LXL04_032319
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 93.023 / OH-1004 25.740 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G165750

Location Chr08:43329418-43333096 (-)

Description Similar to POT4: Potassium transporter 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g02050`	High-affinity potassium transporter.	AtKUP1: an Arabidopsis gene encoding high-affinity potassium transport activity.1998 · DOI: 10.1105/tpc.10.1.51
`At4g23640`	High-affinity potassium transporter required for tip growth of root hairs.	TRH1 encodes a potassium transporter required for tip growth in Arabidopsis root hairs.2001 · DOI: 10.1105/tpc.13.1.139

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0669700`	High-affinity potassium transporter.	Inventory and functional characterization of the HAK potassium transporters of rice.2002 · DOI: 10.1104/pp.007781
`Os01g0935500`	High-affinity potassium transporter.	Rice sodium-insensitive potassium transporter, OsHAK5, confers increased salt tolerance in tobacco BY2 cells.2011 · DOI: 10.1016/j.jbiosc.2010.10.014
`Os01g0369300`	High-affinity potassium transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032319 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009932 cell tip growth Biological Process

GO:0048825 cotyledon development Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0015079 potassium ion transmembrane transporter activity Molecular Function

GO:0015081 sodium ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G02050

ath:AT4G23640

dosa:Os01g0369300

dosa:Os01g0935500

dosa:Os07g0669700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.352

Rank 1 · TkA08G165750 · TK1151

Nucleus0.290

Rank 2 · TkA08G165750 · TK1151

Cell membrane0.214

Rank 3 · TkA08G165750 · TK1151

Mitochondrion0.163

Rank 4 · TkA08G165750 · TK1151

Endoplasmic reticulum0.121

Rank 5 · TkA08G165750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22776K_trans_C16-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G165750	`PF22776`	K_trans_C	16	213	4.6e-11	43.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LD18`	Arabidopsis thaliana	sp\|Q9LD18\|POT4_ARATH Potassium transporter 4	62.600%	Swiss-Prot	High
`Q9FE38`	Arabidopsis thaliana	sp\|Q9FE38\|POT3_ARATH Potassium transporter 3	46.000%	Swiss-Prot	Medium
`Q8H3P9`	Oryza sativa subsp. japonica	sp\|Q8H3P9\|HAK7_ORYSJ Potassium transporter 7	59.400%	Swiss-Prot	High
`Q942X8`	Oryza sativa subsp. japonica	sp\|Q942X8\|HAK2_ORYSJ Probable potassium transporter 2	58.200%	Swiss-Prot	High
`Q5ZC87`	Oryza sativa subsp. japonica	sp\|Q5ZC87\|HAK3_ORYSJ Probable potassium transporter 3	50.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card