TkA08G165150 | RubberDandelionOmics

Gene overview

TkA08G165150

Reference: TK1151 Chr: Chr08 Coordinates: 43138984-43141062 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1571 bp · TkA08G165150|TK1151|cDNA

ATATAACATGACACTTGTTTACGCCCAAATTTTCTGCCCCTTCGCACCTTATCTCCCACAAACACAATCTTCATCTATCTATCTCTCTCACTCTCACTCTCCCTCTCCTCGGTGACAACAATGGCGTCCTTGGCGCACCAAATTGGTGGACTGAGGTGTCCATCTCTCTCGAATACACATCTATCACGAAAACATTCGTTCACCAACACTCAAACTGTGAAGAGAATCTTTACAACCAAAGCTGCAGTTGCTGTATCAAA...

CDS

Download CDS FASTA

1041 bp · TkA08G165150|TK1151|CDS

ATGGCGTCCTTGGCGCACCAAATTGGTGGACTGAGGTGTCCATCTCTCTCGAATACACATCTATCACGAAAACATTCGTTCACCAACACTCAAACTGTGAAGAGAATCTTTACAACCAAAGCTGCAGTTGCTGTATCAAACGCACAGACGAGAGAGAGAATGAAACTCAAAGAAATGTTCGAAGATGCTTACGAGCGATGCCGTAATGCTCCCTACGAAGGTGTTGCCTTCACCGTCGATGATTTTCACGCTGCCATTGA...

Protein

Download Protein FASTA

346 aa · TkA08G165150|TK1151|PROTEIN

MASLAHQIGGLRCPSLSNTHLSRKHSFTNTQTVKRIFTTKAAVAVSNAQTRERMKLKEMFEDAYERCRNAPYEGVAFTVDDFHAAIEKYDYNSEIGTKVKGTVFNVDANGALVDVTAKSSAFLPIREACIHGIKHVEEAGIVPGMREEFVIIGENEHDDSLILSLRQIQYDLAWERCRQLQAEDVVLTGKVVGANKGGIVAIVEGLRGFVPFSQISSKSSAEDLLEKDLPLKFVEVDEEQSRLVLSNRKAMADSQAQLGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G165150`
TK1151 ID	TkA08G165150
OH-1004 ID	LXL04_032313
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 84.185 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G165150

Location Chr08:43138984-43141062 (+)

Description Similar to RPS1: 30S ribosomal protein S1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g30510`	Required for optimal plastid performance in terms of photosynthesis and growth.	Downregulation of chloroplast RPS1 negatively modulates nuclear heat-responsive expression of HsfA2 and its target genes in Arabidopsis.2012 · DOI: 10.1371/journal.pgen.1002669

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032313 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0005840 ribosome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT5G30510

syc:syc0836_d

syf:Synpcc7942_1591

syn:slr1356

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.961

Rank 1 · TkA08G165150 · TK1151

Mitochondrion0.047

Rank 2 · TkA08G165150 · TK1151

Nucleus0.033

Rank 3 · TkA08G165150 · TK1151

Cytoplasm0.024

Rank 4 · TkA08G165150 · TK1151

Cell membrane0.012

Rank 5 · TkA08G165150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21266S1_RRP491-129 aa

PF00575S194-166 aa

PF13509S1_295-128 aa

PF23459S1_RRP596-165 aa

PF01330RuvA_N98-115 aa

PF00575S1183-246 aa

PF23459S1_RRP5183-218 aa

PF01330RuvA_N187-205 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G165150	`PF21266`	S1_RRP4	91	129	0.17	12.8
TkA08G165150	`PF00575`	S1	94	166	3.6e-36	124.1
TkA08G165150	`PF13509`	S1_2	95	128	0.02	15.7
TkA08G165150	`PF23459`	S1_RRP5	96	165	5.2e-10	40.5
TkA08G165150	`PF01330`	RuvA_N	98	115	0.32	11.8
TkA08G165150	`PF00575`	S1	183	246	3.6e-36	124.1
TkA08G165150	`PF23459`	S1_RRP5	183	218	5.2e-10	40.5
TkA08G165150	`PF01330`	RuvA_N	187	205	0.32	11.8
TkA08G165150	`PF00575`	S1	260	329	3.6e-36	124.1
TkA08G165150	`PF13509`	S1_2	260	294	0.02	15.7
TkA08G165150	`PF21266`	S1_RRP4	260	290	0.17	12.8
TkA08G165150	`PF23459`	S1_RRP5	261	327	5.2e-10	40.5
TkA08G165150	`PF01330`	RuvA_N	264	320	0.32	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VC7`	Arabidopsis thaliana	sp\|Q93VC7\|RPS1_ARATH Small ribosomal subunit protein bS1c	79.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card