LXL04_032313 | RubberDandelionOmics

Gene overview

LXL04_032313

Reference: OH-1004 Chr: Chr07 Coordinates: 20292202-20293947 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1236 bp · LXL04_032313|LXL04_032313|OH1004|cDNA

ATGGCGTCCTTGGCGCACCAAATTGGTGGACTGAGGTGTCCATCTCTCTCGAATACACATCTATCAAGAAAACATTCGTTCACCAACACTCAAACTGTGAAGAGAATCTTTACAACCAAAGCTGCAGTTGCTGTATCAAACGCACAGACGAGAGAGAGAATGAAACTCAAAGAAATGTTCGAAGATGCTTACGAGCGATGCCGTAATGCTCCCTACGAAGGTGTTGCCTTCACCGTCGATGATTTTCACGCTGCCATTGA...

CDS

Download CDS FASTA

1236 bp · LXL04_032313|LXL04_032313|OH1004|CDS

ATGGCGTCCTTGGCGCACCAAATTGGTGGACTGAGGTGTCCATCTCTCTCGAATACACATCTATCAAGAAAACATTCGTTCACCAACACTCAAACTGTGAAGAGAATCTTTACAACCAAAGCTGCAGTTGCTGTATCAAACGCACAGACGAGAGAGAGAATGAAACTCAAAGAAATGTTCGAAGATGCTTACGAGCGATGCCGTAATGCTCCCTACGAAGGTGTTGCCTTCACCGTCGATGATTTTCACGCTGCCATTGA...

Protein

Download Protein FASTA

411 aa · LXL04_032313|LXL04_032313|OH1004|PROTEIN

MASLAHQIGGLRCPSLSNTHLSRKHSFTNTQTVKRIFTTKAAVAVSNAQTRERMKLKEMFEDAYERCRNAPYEGVAFTVDDFHAAIEKYDYNSEIGTKVKGTVFNVDANGALVDVTAKSSAFLPIREACIHGIKHVEEAGIVPGMREEFVIIGENEHDDSLILSLRQIQYDLAWERCRQLQAEDVVLTGKVVGANKGGIVAIVEGLRGFVPFSQISSKSSAEDLLEKDLPLKFVEVDEEQSRLVLSNRKAMADSQAQLGI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032313`
TK1151 ID	TkA08G165150
OH-1004 ID	LXL04_032313
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 84.185 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032313

Location Chr07:20292202-20293947 (+)

Description Similar to RPS1: 30S ribosomal protein S1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g30510`	Required for optimal plastid performance in terms of photosynthesis and growth.	Downregulation of chloroplast RPS1 negatively modulates nuclear heat-responsive expression of HsfA2 and its target genes in Arabidopsis.2012 · DOI: 10.1371/journal.pgen.1002669

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032313 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0005840 ribosome Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0003735 structural constituent of ribosome Molecular Function

KEGG gene cross-reference

ath:AT5G30510

syc:syc0836_d

syf:Synpcc7942_1591

syn:slr1356

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.955

Rank 1 · LXL04_032313 · OH-1004

Mitochondrion0.057

Rank 2 · LXL04_032313 · OH-1004

Nucleus0.035

Rank 3 · LXL04_032313 · OH-1004

Cytoplasm0.027

Rank 4 · LXL04_032313 · OH-1004

Cell membrane0.012

Rank 5 · LXL04_032313 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00575.30S194-166 aa

PF00575.30S1183-246 aa

PF00575.30S1260-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032313	`PF00575.30`	S1	94	166	8.4e-36	122.9
LXL04_032313	`PF00575.30`	S1	183	246	8.4e-36	122.9
LXL04_032313	`PF00575.30`	S1	260	329	8.4e-36	122.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VC7`	Arabidopsis thaliana	Small ribosomal subunit protein bS1c	77.590%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card