TkA08G165120 | RubberDandelionOmics

Gene overview

TkA08G165120

Reference: TK1151 Chr: Chr08 Coordinates: 43133642-43134136 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

495 bp · TkA08G165120|TK1151|cDNA

TTTCTTATTTTGTTCTTAATATTTCTTTCATCCAGCACTTTCACAAATGGCGACTTAATCAAGAAGATTTGCCAACAAACAAGTGATCCTTCCTTATGCTCCAACTCTTTTCATTCAGACCCTCGTTCAGCCAATGCAAGTCTTACCATCCTTGGCCACATCTCCATCAAGAACGCCCAAAAATCTGCAAAATCAGTCAAGAAACTTATACATTCTGTCTCATATTCTGGAAACTACACAGAATGTATATCACTATATGA...

CDS

Download CDS FASTA

495 bp · TkA08G165120|TK1151|CDS

TTTCTTATTTTGTTCTTAATATTTCTTTCATCCAGCACTTTCACAAATGGCGACTTAATCAAGAAGATTTGCCAACAAACAAGTGATCCTTCCTTATGCTCCAACTCTTTTCATTCAGACCCTCGTTCAGCCAATGCAAGTCTTACCATCCTTGGCCACATCTCCATCAAGAACGCCCAAAAATCTGCAAAATCAGTCAAGAAACTTATACATTCTGTCTCATATTCTGGAAACTACACAGAATGTATATCACTATATGA...

Protein

Download Protein FASTA

164 aa · TkA08G165120|TK1151|PROTEIN

FLILFLIFLSSSTFTNGDLIKKICQQTSDPSLCSNSFHSDPRSANASLTILGHISIKNAQKSAKSVKKLIHSVSYSGNYTECISLYEDAISNLKKCKKALKAHDYGELNTLVSGAMTDASMCDGSFGRGVKGPPQLKFASLKLQGLCNIILVISSNLSGIKMFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G165120`
TK1151 ID	TkA08G165120
OH-1004 ID	LXL04_032312
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 95.349 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA08G165120`
Location	Chr08:43133642-43134136 (+)
Description	Similar to PMEI: Pectinesterase inhibitor
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_032312` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0009555 pollen development Biological Process GO:0009846 pollen germination Biological Process GO:0009860 pollen tube growth Biological Process GO:0005576 extracellular region Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0009507 chloroplast Cellular Component GO:0012505 endomembrane system Cellular Component GO:0043667 pollen wall Cellular Component GO:0048046 apoplast Cellular Component GO:0090404 pollen tube tip Cellular Component GO:0004857 enzyme inhibitor activity Molecular Function
KEGG gene cross-reference	ath:AT3G17220 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.510

Rank 1 · TkA08G165120 · TK1151

Endoplasmic reticulum0.186

Rank 2 · TkA08G165120 · TK1151

Cytoplasm0.145

Rank 3 · TkA08G165120 · TK1151

Lysosome / Vacuole0.104

Rank 4 · TkA08G165120 · TK1151

Cell membrane0.089

Rank 5 · TkA08G165120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02609Exonuc_VII_S13-26 aa

PF04043PMEI18-153 aa

PF04212MIT76-98 aa

PF02609Exonuc_VII_S81-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G165120	`PF02609`	Exonuc_VII_S	13	26	0.35	11.6
TkA08G165120	`PF04043`	PMEI	18	153	3.3e-23	83.3
TkA08G165120	`PF04212`	MIT	76	98	0.13	13.1
TkA08G165120	`PF02609`	Exonuc_VII_S	81	102	0.35	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card