LXL04_032312 | RubberDandelionOmics

Gene overview

LXL04_032312

Reference: OH-1004 Chr: Chr07 Coordinates: 20289853-20290371 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

519 bp · LXL04_032312|LXL04_032312|OH1004|cDNA

ATGAGAATTTCGCTCAACAACTCTTTCTTGTTTTTGTTCTTAATATTTCTTTCATCCAGCACTTTCACAAATGGCGACTTAATCAAGAAGATTTGCCAACAAACCAGTGACCCTTCCTTATGCTCCAACTCTTTTCATTCAGACCCTCGTTCAGTCAATGCAAGTCTTACCATCCTTGGCCACATCTCCATCAAGAACGCCCAAAAGTCTGCAAAATCAATCAAGAAACTTATACATTCAGTCTCATATTCTGGAAACTA...

CDS

Download CDS FASTA

519 bp · LXL04_032312|LXL04_032312|OH1004|CDS

ATGAGAATTTCGCTCAACAACTCTTTCTTGTTTTTGTTCTTAATATTTCTTTCATCCAGCACTTTCACAAATGGCGACTTAATCAAGAAGATTTGCCAACAAACCAGTGACCCTTCCTTATGCTCCAACTCTTTTCATTCAGACCCTCGTTCAGTCAATGCAAGTCTTACCATCCTTGGCCACATCTCCATCAAGAACGCCCAAAAGTCTGCAAAATCAATCAAGAAACTTATACATTCAGTCTCATATTCTGGAAACTA...

Protein

Download Protein FASTA

172 aa · LXL04_032312|LXL04_032312|OH1004|PROTEIN

MRISLNNSFLFLFLIFLSSSTFTNGDLIKKICQQTSDPSLCSNSFHSDPRSVNASLTILGHISIKNAQKSAKSIKKLIHSVSYSGNYTECISLYEDAISNLKKCKKALKAHDYGELNTLVSGAMTDASMCDGSFGRGVKGPPQLKFASLKLQGLCNIILVISSNLSGIKMFV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032312`
TK1151 ID	TkA08G165120
OH-1004 ID	LXL04_032312
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 95.349 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032312

Location Chr07:20289853-20290371 (+)

Description Similar to PMEI: Pectinesterase inhibitor

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g17220`	Inhibits pectin methylesterase (PME) from flowers, siliques and pollen tube.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032312 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0043667 pollen wall Cellular Component

GO:0048046 apoplast Cellular Component

GO:0090404 pollen tube tip Cellular Component

GO:0004857 enzyme inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT3G17220

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.475

Rank 1 · LXL04_032312 · OH-1004

Endoplasmic reticulum0.203

Rank 2 · LXL04_032312 · OH-1004

Cytoplasm0.136

Rank 3 · LXL04_032312 · OH-1004

Lysosome / Vacuole0.109

Rank 4 · LXL04_032312 · OH-1004

Cell membrane0.105

Rank 5 · LXL04_032312 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04043.21PMEI26-161 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032312	`PF04043.21`	PMEI	26	161	9.2e-23	81.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUV1`	Arabidopsis thaliana	Pectinesterase inhibitor 2	31.579%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card