TkA08G163850 | RubberDandelionOmics

Gene overview

TkA08G163850

Reference: TK1151 Chr: Chr08 Coordinates: 42755889-42757013 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

870 bp · TkA08G163850|TK1151|cDNA

AGGATCTGCTTCCTTTCAAGTATTTCAATACTTGTTCTAAAACCACTTGGCTCCGGCCACCGCAGCACCGCCGTCTGCTCCCCTCCTCCTTCCATAACCACCACCATCATGAAGTTTTTCAATTGGATGCAAAGTAAAATTAATGGCGGACAAAGGTGTAAGAACACTAATGCCTCCTCCACTTCTCATCAAATGAACGAAGCTCCGAAAGAGGAGTTTAGTGATTGGCATCACGGATTGCTAACAATAGGAACATTTGG...

CDS

Download CDS FASTA

870 bp · TkA08G163850|TK1151|CDS

AGGATCTGCTTCCTTTCAAGTATTTCAATACTTGTTCTAAAACCACTTGGCTCCGGCCACCGCAGCACCGCCGTCTGCTCCCCTCCTCCTTCCATAACCACCACCATCATGAAGTTTTTCAATTGGATGCAAAGTAAAATTAATGGCGGACAAAGGTGTAAGAACACTAATGCCTCCTCCACTTCTCATCAAATGAACGAAGCTCCGAAAGAGGAGTTTAGTGATTGGCATCACGGATTGCTAACAATAGGAACATTTGG...

Protein

Download Protein FASTA

289 aa · TkA08G163850|TK1151|PROTEIN

RICFLSSISILVLKPLGSGHRSTAVCSPPPSITTTIMKFFNWMQSKINGGQRCKNTNASSTSHQMNEAPKEEFSDWHHGLLTIGTFGNNDLPVDQNEEILETSSPDLSEFTPEEVGKLQNELTKLLSKKPAETIDLPLDRFLNCPSSLEVDRRVSVTVNGDKEEDIDRTIRVILGRCKDICMDNSKKAIGKKKSISFIFKKMFACSSGFPAIPSLRDPLPESRMEKLLKAMLKNKINPQNSSQSSSRTKFIEGKRPLKKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G163850`
TK1151 ID	TkA08G163850
OH-1004 ID	LXL04_032289
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 96.980 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G163850

Location Chr08:42755889-42757013 (-)

Description Protein of unknown function

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17400`	Involved in the regulation of root gravitropism.	The Arabidopsis LAZY1 Family Plays a Key Role in Gravity Signaling within Statocytes and in Branch Angle Control of Roots and Shoots.2017 · DOI: 10.1105/tpc.16.00575 LAZY Genes Mediate the Effects of Gravity on Auxin Gradients and Plant Architecture.2017 · DOI: 10.1104/pp.17.00942
`At1g72490`	Involved in the regulation of root gravitropism.	DRO1 influences root system architecture in Arabidopsis and Prunus species.2017 · DOI: 10.1111/tpj.13470 The Arabidopsis LAZY1 Family Plays a Key Role in Gravity Signaling within Statocytes and in Branch Angle Control of Roots and Shoots.2017 · DOI: 10.1105/tpc.16.00575 LAZY Genes Mediate the Effects of Gravity on Auxin Gradients and Plant Architecture.2017 · DOI: 10.1104/pp.17.00942 AtDRO1 is nuclear localized in root tips under native conditions and impacts auxin localization.2020 · DOI: 10.1007/s11103-020-00984-2

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0439800`	Involved in the control of root growth angle.	Control of root system architecture by DEEPER ROOTING 1 increases rice yield under drought conditions.2013 · DOI: 10.1038/ng.2725

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032289 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009630 gravitropism Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0040008 regulation of growth Biological Process

GO:0080181 lateral root branching Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009501 amyloplast Cellular Component

KEGG gene cross-reference

ath:AT1G17400

ath:AT1G72490

dosa:Os09g0439800

mtr:25500557

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.470

Rank 1 · TkA08G163850 · TK1151

Nucleus0.367

Rank 2 · TkA08G163850 · TK1151

Cytoplasm0.321

Rank 3 · TkA08G163850 · TK1151

Endoplasmic reticulum0.072

Rank 4 · TkA08G163850 · TK1151

Plastid0.037

Rank 5 · TkA08G163850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28425LAZY_C43-283 aa

PF16273NuDC54-69 aa

PF16273NuDC101-124 aa

PF16273NuDC259-272 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G163850	`PF28425`	LAZY_C	43	283	2.7e-92	309.9
TkA08G163850	`PF16273`	NuDC	54	69	0.87	10.9
TkA08G163850	`PF16273`	NuDC	101	124	0.87	10.9
TkA08G163850	`PF16273`	NuDC	259	272	0.87	10.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q58G53`	Arabidopsis thaliana	sp\|Q58G53\|LAZY2_ARATH Protein LAZY 2	47.400%	Swiss-Prot	Medium
`Q5XVG3`	Arabidopsis thaliana	sp\|Q5XVG3\|LAZY4_ARATH Protein LAZY 4	47.000%	Swiss-Prot	Medium
`Q69P88`	Oryza sativa subsp. japonica	sp\|Q69P88\|DRO1_ORYSJ Protein DEEPER ROOTING 1	33.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card