TkA08G162940 | RubberDandelionOmics

Gene overview

TkA08G162940

Reference: TK1151 Chr: Chr08 Coordinates: 42498761-42500300 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1405 bp · TkA08G162940|TK1151|cDNA

TTATTTCTTTCAAGACCTCCGTCAATCTTCCCATTTTCCGAATCTCTCATTTCACTTCTCAAGACTCATCATTTCTCCCCCAAATTTCATTCACCATTTCAATCGATTATTAGCCTCTGAGCGAATTTACTTCAGATTTTATTACCAGATATGTGTGGGGGTGCCATCATCTCCGATTGCATTACGCCGGCCACTAATCGGTCTCCTCGTTTGACCGCCGAACTTCTCTGGAACACCCATTTCGCAACCAACTTAACCAA...

CDS

Download CDS FASTA

573 bp · TkA08G162940|TK1151|CDS

ATGTGTGGGGGTGCCATCATCTCCGATTGCATTACGCCGGCCACTAATCGGTCTCCTCGTTTGACCGCCGAACTTCTCTGGAACACCCATTTCGCAACCAACTTAACCAATCGCTACTCAAAGCGATTCCCGTCTCGCCATGTAGATCTTGACGATGATTTCGAGGCTGATTTCCTGGGATTTCAGGACGAGCTGGAACGTGAAGAGGGTATCGTCAAGTCTGTTCCTGTCTCTTCATCCAAACACTCTGCTTCTGCTTC...

Protein

Download Protein FASTA

190 aa · TkA08G162940|TK1151|PROTEIN

MCGGAIISDCITPATNRSPRLTAELLWNTHFATNLTNRYSKRFPSRHVDLDDDFEADFLGFQDELEREEGIVKSVPVSSSKHSASASGLSSIKQDDEDEKLASSRKRKNQYRGIRQRPWGKWAAEIRDPSKGVRVWLGTFNTAEEAAHAYDTEARRIRGTKAKVNFPTVTASRHAIKPKSRKSLRRLTQL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA08G162940`
TK1151 ID	TkA08G162940
OH-1004 ID	LXL04_037965
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.600
Protein coverage (%)	TK1151 55.789 / OH-1004 23.077 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA08G162940

Location Chr08:42498761-42500300 (+)

Description Similar to EREBP1: Ethylene-responsive transcription factor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14230`	Transcription factor involved in carotenoid biosynthesis regulation.	Arabidopsis RAP2.2: an ethylene response transcription factor that is important for hypoxia survival.2010 · DOI: 10.1104/pp.110.155077
`At1g53910`	Transcription factor involved in the activation of hypoxic gene expression and in ethylene response.	No verified direct reference in this release
`At1g72360`	Transcriptional activator involved in the hypoxic stress response.	HRE1 and HRE2, two hypoxia-inducible ethylene response factors, affect anaerobic responses in Arabidopsis thaliana.2010 · DOI: 10.1111/j.1365-313x.2010.04149.x The AP2/ERF transcription factor AtERF73/HRE1 modulates ethylene responses during hypoxia in Arabidopsis.2011 · DOI: 10.1104/pp.111.172486 The hypoxia responsive transcription factor genes ERF71/HRE2 and ERF73/HRE1 of Arabidopsis are differentially regulated by ethylene.2011 · DOI: 10.1111/j.1399-3054.2011.01486.x Arabidopsis HRE1α, a splicing variant of AtERF73/HRE1, functions as a nuclear transcription activator in hypoxia response and root development.2014 · DOI: 10.1007/s00299-014-1613-8 Two Alternative Splicing Variants of AtERF73/HRE1, HRE1α and HRE1β, Have Differential Transactivation Activities in Arabidopsis.2020 · DOI: 10.3390/ijms21196984
`At2g47520`	Transcriptional activator that binds specifically to the cis- acting element GCC box 5'-AGCCGCC-3', or to the CRT/DRE element 5'- [AG]CCGAC-3'.	HRE1 and HRE2, two hypoxia-inducible ethylene response factors, affect anaerobic responses in Arabidopsis thaliana.2010 · DOI: 10.1111/j.1365-313x.2010.04149.x The hypoxia responsive transcription factor genes ERF71/HRE2 and ERF73/HRE1 of Arabidopsis are differentially regulated by ethylene.2011 · DOI: 10.1111/j.1399-3054.2011.01486.x AtERF71/HRE2 transcription factor mediates osmotic stress response as well as hypoxia response in Arabidopsis.2011 · DOI: 10.1016/j.bbrc.2011.09.039 Homeostatic response to hypoxia is regulated by the N-end rule pathway in plants.2011 · DOI: 10.1038/nature10534 Arabidopsis AtERF71/HRE2 functions as transcriptional activator via cis-acting GCC box or DRE/CRT element and is involved in root development through regulation of root cell expansion.2015 · DOI: 10.1007/s00299-014-1701-9 Hypoxia and the group VII ethylene response transcription factor HRE2 promote adventitious root elongation in Arabidopsis.2019 · DOI: 10.1111/plb.12873 The possible roles of AtERF71 in the defense response against the Fusarium graminearum .2018 · DOI: 10.5511/plantbiotechnology.18.0501b

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0782700`	Probable transcriptional activator that may be involved in defense signaling pathway.	BWMK1, a rice mitogen-activated protein kinase, locates in the nucleus and mediates pathogenesis-related gene expression by activation of a transcription factor.2003 · DOI: 10.1104/pp.103.023176

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037965 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0046148 pigment biosynthetic process Biological Process

GO:0070483 detection of hypoxia Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G53910

ath:AT3G14230

mdm:103446446

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.899

Rank 1 · TkA08G162940 · TK1151

Cytoplasm0.123

Rank 2 · TkA08G162940 · TK1151

Plastid0.038

Rank 3 · TkA08G162940 · TK1151

Cell membrane0.031

Rank 4 · TkA08G162940 · TK1151

Endoplasmic reticulum0.024

Rank 5 · TkA08G162940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP2110-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA08G162940	`PF00847`	AP2	110	159	9.8e-13	48.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUM4`	Arabidopsis thaliana	sp\|Q9LUM4\|RAP22_ARATH Ethylene-responsive transcription factor RAP2-2	53.400%	Swiss-Prot	High
`Q9SSA8`	Arabidopsis thaliana	sp\|Q9SSA8\|RA212_ARATH Ethylene-responsive transcription factor RAP2-12	49.700%	Swiss-Prot	Medium
`Q8H0T5`	Arabidopsis thaliana	sp\|Q8H0T5\|ERF73_ARATH Ethylene-responsive transcription factor ERF073	54.800%	Swiss-Prot	Medium
`O22259`	Arabidopsis thaliana	sp\|O22259\|ERF71_ARATH Ethylene-responsive transcription factor ERF071	74.600%	Swiss-Prot	Low
`Q6K7E6`	Oryza sativa subsp. japonica	sp\|Q6K7E6\|ERF1_ORYSJ Ethylene-responsive transcription factor 1	50.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card